(data stored in ACNUC7421 zone)

EMBL: CP000462.PE594

CP000462.PE594       Location/Qualifiers
FT   CDS_pept        662465..662956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0618"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38290"
FT                   /db_xref="GOA:A0KFX5"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFX5"
FT                   /protein_id="ABK38290.1"
FT                   /translation="MPRDGMRAVLLCLLGLWPALSFATLSADMVVVKKSSYSLTLMKDG
FT                   KEVKRYWIALGPAPKGHKQREGDQRTPEGRYILDYKKTNSNYYKAIHINYPNLDDIKAA
FT                   NEMGVRPGGMIMIHGQRNSIGNTRLQPSNWTNGCIAMLNKDLDEVWNAIEPGTPIVIQP
FT                   "
     ttgccgaggg atggaatgag agccgtatta ctgtgtttgc tggggctgtg gcccgcattg        60
     agttttgcca ccctgtccgc cgatatggtg gtggtgaaga aatcgagtta tagcctgacc       120
     ctgatgaagg atggcaagga ggtcaaacgc tactggatag ctctgggtcc ggctcccaag       180
     gggcacaagc agcgggaagg ggatcagcgc acgccggaag gccgttacat cctcgactac       240
     aagaagacca actccaacta ttacaaggcc atccacatca actacccgaa tctggacgac       300
     atcaaggcgg ccaacgagat gggtgtgcga ccgggcggca tgatcatgat ccacggtcag       360
     cgcaacagca taggcaacac ccgcctgcag ccgtccaact ggaccaatgg ctgcatcgcc       420
     atgctcaaca aggatctgga cgaagtgtgg aacgccatcg aacccggcac ccccatcgtc       480
     attcagccct ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page