(data stored in ACNUC7421 zone)

EMBL: CP000462.PE595

CP000462.PE595       Location/Qualifiers
FT   CDS_pept        663105..663824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0619"
FT                   /product="AzlC family protein"
FT                   /note="identified by match to protein family HMM PF03591"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39046"
FT                   /db_xref="GOA:A0KFX6"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFX6"
FT                   /protein_id="ABK39046.1"
FT                   /translation="MPSATCSRPVGAESTRALWWRASIDILPLSVSVIPWGILCGALAL
FT                   QVGLSPLQAQLMSLLVYAGAAQLSATTLFGAGTPLLPIMGSTFVITSQHLLYGFTFRRD
FT                   VLPLSLRWRASLAFFLTDEMFAVALKDRERSGRFDPAYALIAGFVFYLFWNAATLLGIA
FT                   AGQYIDGLDQMGLDFAIAATFIAMTIPAMKNLPMVAATLVSGAMALLTKPLLAEVYIII
FT                   SALSGMLVGYVLHRMRR"
     atgccatcag caacctgctc ccggcccgtc ggggccgaga gtacccgcgc gctctggtgg        60
     cgcgcctcca tcgatattct gccgctctcc gtctcggtga tcccctgggg gatcctgtgc       120
     ggtgccctgg cgctgcaggt ggggctgagc ccgctgcagg cccagctgat gtcgctgctg       180
     gtctatgccg gcgccgccca gctctcggcc accaccctgt tcggggcggg tacgccgctg       240
     ctgcccatca tgggctccac cttcgtcatc acctcccagc acctgctcta cggcttcacc       300
     tttcgccgcg acgtgctgcc gctctccctg cgctggcgcg ccagtctggc cttctttctg       360
     accgacgaga tgttcgcggt ggcgctcaaa gaccgggagc gcagcggccg cttcgacccg       420
     gcctatgcgc tcatcgccgg cttcgtcttc tatctgttct ggaatgcggc gaccctgctc       480
     ggcatcgccg ccggccagta catcgacggg ctggatcaga tggggctgga cttcgccatc       540
     gccgccacct tcatcgccat gaccattccc gccatgaaga acctgcccat ggtggcggcc       600
     accctggtga gcggtgccat ggcgctgctc accaagccgc tgctggcgga ggtctacatc       660
     atcatctcgg cgctctccgg catgctggtg ggttatgtgc tgcaccggat gaggaggtaa       720
//

If you have problems or comments...

PBIL Back to PBIL home page