(data stored in ACNUC7421 zone)

EMBL: CP000462.PE596

CP000462.PE596       Location/Qualifiers
FT   CDS_pept        664285..665811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38585"
FT                   /db_xref="InterPro:IPR016905"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFX7"
FT                   /protein_id="ABK38585.1"
FT                   /translation="MSFTETCQRIVRDPLLSPAQKSHALALAAENALPYPELPAEVSEA
FT                   MAKGFVCDMFEGHAPYKPRYVLPDYEKFLRQGSAWLELAPPQDFDEALDALRILYHHVP
FT                   SVTGMPVWLGRLDHLLLPFVGELDDEALYRKLKGFWIYLDRVLPDAFMHVNIGPDDNRL
FT                   CRLILRIDGDLKQVAPNLTLFHDPAQTPDSLLLQGVKNIAACSKPHIANYPLHRNTFDE
FT                   RGFGIVSCYNALPQAGGANTLVRVSLKRVAEQAHGIDDFLGCLLPHYCRLASRLIEARA
FT                   AFLHQESGFFDSFLVQEGLLEEDRFVPMFGIYGMAEAVNLLMDKENLPERYGRDEEANQ
FT                   LGYRISAQLARHVSEAPQVHAWGGRALLHSQGGLSVDRGVTPGVRIPYGEEPDPASHML
FT                   ALAPHHGFYHSGISEILTLDPTIRQNPQALLQLCKGALAIGMREFTANVADSDLVRVTG
FT                   YMIRKSDVARFATEGSRLQTTCLGAEASELTGIRQRAPRVVGREATLCDY"
     atgtccttca ccgaaacctg tcagcgcatc gtgcgcgatc ccctgctgtc accggcccag        60
     aagagccatg ccctggcgct ggccgccgaa aatgcgctgc cctatcccga gctgcccgcc       120
     gaggtgagcg aggcgatggc caagggcttt gtctgcgaca tgttcgaggg gcacgccccc       180
     tacaagccgc gctatgtgct gccggattac gagaagtttc tgcgccaggg ctcggcctgg       240
     ctggagctgg caccgccgca ggatttcgac gaggcgctcg atgccctgcg catcctctac       300
     caccatgtgc cctccgtcac cggcatgccg gtctggctgg gccggctcga ccacctgctg       360
     ctgcccttcg tcggtgagct ggatgacgag gcgctctatc gcaagctgaa ggggttctgg       420
     atctacctgg accgggtgct gccggatgcc ttcatgcacg tcaacatagg cccggacgac       480
     aaccggctct gccgcctgat cctgcgtatc gacggcgatc tcaagcaggt ggcccccaac       540
     ctcaccctgt tccacgatcc ggcgcagact ccggacagcc tgttgctgca gggggtgaag       600
     aacatagcgg cctgcagcaa gccccacatc gccaactacc cgctgcatcg caacaccttc       660
     gatgagcgcg gcttcggcat cgtcagctgc tacaacgccc tgccccaggc gggtggcgcc       720
     aacaccctgg tgcgggtctc cctcaagcgg gtggccgagc aggcccacgg catcgacgac       780
     ttcctgggct gcctgctgcc ccactactgc cgcctcgcct cccgtctgat cgaggcgcgt       840
     gccgccttcc tgcaccagga gtccggtttc ttcgacagct tcctggtgca ggaggggctg       900
     ctggaagagg atcgcttcgt gcccatgttc ggcatttacg gcatggccga ggcggtcaac       960
     ctcctgatgg acaaggagaa cctgccggag cgctacggcc gggacgaaga ggcgaaccag      1020
     ctgggctacc gcatctcggc ccagctcgcc cgccacgtga gcgaagcgcc gcaggtgcac      1080
     gcctggggtg gccgcgccct gctccactcc cagggcgggc tcagcgtgga tcgcggggtg      1140
     acccccgggg tacgcatccc ctatggcgag gagccggatc ccgccagcca catgctggcg      1200
     ctggcgcccc accacggctt ctatcactcc gggatcagcg agatcctcac cctggatccc      1260
     accatccgcc agaacccgca ggcgctgctg cagctgtgca agggggcgct cgccatcggc      1320
     atgcgcgagt tcaccgccaa cgtggcggac agcgatctgg tgcgggtgac cggctacatg      1380
     atccgcaaga gcgacgtggc ccgcttcgcg accgagggct cgcggctgca gaccacctgc      1440
     ctcggcgccg aggcgagcga actgaccggg atccgccagc gggcgccgcg ggtggtgggg      1500
     cgcgaggcga ccctgtgtga ctactga                                          1527
//

If you have problems or comments...

PBIL Back to PBIL home page