(data stored in ACNUC7421 zone)

EMBL: CP000462.PE599

CP000462.PE599       Location/Qualifiers
FT   CDS_pept        complement(667259..668182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0623"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37073"
FT                   /db_xref="GOA:A0KFY0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFY0"
FT                   /protein_id="ABK37073.1"
FT                   /translation="MDLIALSRLGGRHLVTLHLLLDSQSVTRTAERLCTTPSTVSKTLN
FT                   QLRDLLGDQLLYRQGNQLLLTPFAERLGPTLHRLLSELNGLTGQGGFDPASWQGQLTFA
FT                   LRESGMVWPMGPILAQLMREVPGLVPDIRNKDEQGLAALAAGKLDFVILPHDQSQPLPR
FT                   QQGLVWETLREDKLVCLLRADHPALARSWDLDAYLSWRHIAIRDQELANPFFEQSLAQL
FT                   QVRRQIAAILPDFGSAAALLRQSDLILTAIGGWAEQAAPHALVSRPVPFDYGAVTHSLV
FT                   WYGPAGEEPARRWFRQRILQLARELG"
     atggatctca ttgccctctc ccgcctcggc ggtcgccatc tggttaccct gcacctgctg        60
     ctcgacagcc agagcgtcac ccgcaccgcc gagcggctct gcaccacccc ctccaccgtc       120
     agcaagactc tcaaccagct gcgggatctg ctcggtgatc agctgctcta ccgccagggc       180
     aaccagctgc tgctgacccc gttcgccgag cggctcggcc ctaccctgca ccggctgctg       240
     agcgagctga acggcctcac cggccagggc gggttcgatc ccgccagctg gcaggggcag       300
     ctgacattcg ccctgcgcga gagcggcatg gtctggccca tggggcccat tctggcgcag       360
     ctgatgcgcg aggtgccggg cctggtgccc gacattcgca acaaggatga gcaggggctg       420
     gctgccctgg cggcgggcaa gctggacttc gtgatcctgc cccacgatca gagccagccg       480
     ctgccccgcc agcaagggct ggtgtgggag accctgcgcg aagacaagct ggtctgcctg       540
     ctgcgcgcgg atcacccggc gctggcgcga tcctgggatc tcgatgccta cctgagctgg       600
     cgccatatcg ccattcgcga tcaggagctg gccaacccct tcttcgaaca gagcctggcc       660
     cagttgcagg tgcgccggca gattgccgcc atcctgccgg attttggcag tgcggcagcc       720
     ctgctgcgcc agagcgatct gatcctcacc gccatcggtg gctgggccga gcaggcggcc       780
     ccccacgctc tggtgagcag gccggtgccc ttcgattacg gcgccgtcac ccacagcctg       840
     gtgtggtacg gcccggccgg agaagagccg gcccggcgct ggtttcgcca gcgcatcctg       900
     caactggccc gcgagctggg atga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page