(data stored in ACNUC7421 zone)

EMBL: CP000462.PE60

CP000462.PE60        Location/Qualifiers
FT   CDS_pept        68963..72550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0064"
FT                   /product="virulence sensor protein BvgS"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF01627; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36911"
FT                   /db_xref="GOA:A0KEB2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEB2"
FT                   /protein_id="ABK36911.1"
FT                   /translation="MRHWFAALLVCCCASWASAHELAAPYLHVYARNDSEYLEKQTLPL
FT                   HAEDWLWLRNRGRLVLGVPMPDNPPMDITLRANAYEGVTADIVGMLSHLLRVEIVVKNL
FT                   PSRAAAIAALKRGEVDLLSTSNAYEEEQQLLLTDKYMPDDPAIYKNIHVKERDIRTVAV
FT                   PEYYLPALDVMRYLPKVQIKMYSSRYSALSAVAYGQVDAVMLDMISGNFIVNKFYQDSI
FT                   QLLKPLYIDTHGFSFSLERKNQRLKKIINIALDEILEGKREEIAKRWNGGGLSIGASKV
FT                   ELTSEQWAWLGQQKKIRMAVNSGVPPLSFLDINDTLHGVVADLLQVLRAKLGVEIEVVP
FT                   VKTPGQMLQLLDGGQVDIAVLSPSEERRSRYLFSRAFVLDPLAYVVGVRHEATAPETLL
FT                   KTGTVAIIKDFISEQAIEEEYGKLTTRKFERIEDALRCVASETCDVTVLPLRVAKYYIN
FT                   SKFPDSLLITGELFDSIPIGAAFAVSPKQHMLRDILDRVIAIIPPDELEGLSNRWRVST
FT                   QQEAITWQELVREFGGIIALIMLLTIWIGLWGLSLHKQVRQRRAAEVALSAQLKFIEDL
FT                   VDGTPHPIYARDREDRLVLCNSTYASFFGEDKSRLLGSTMAEDVQRWPFLAPLFEDLST
FT                   ARTVRCARQGDHRLSMATGSVAVYHWVQPYYDLEGNVQGGIGGWIDVSERLRLLEELAL
FT                   ASQDAQEANRAKSTFLATMSHEIRTPMNAIIGLLELTLRRDRLHEEDKTSLSIAHGSAK
FT                   DLLSLIGDILDISKIESGRLELRPEPHEITALTASVVTVFTALARQKNLQLELAAGEPR
FT                   WVQIDGICYKQILSNLISNAIKYTEQGAVRVELQSKTSDGWCTLQLVIRDTGIGIAPAE
FT                   QARLFQPFGQARQPEHIQRSGTGLGLMISRSLCESMGGSLLLESEPGHGTCISIEMKVP
FT                   LASAVESVTPVALGTMTGHHRRLRVMIVDDHPTNRLLVSQQLAYLGHDATAAESGREAL
FT                   ALFANTPFDVMITDFNMPGMSGFELTRQYRALELSRGTHRCLILGLTADARQEQVSEGL
FT                   TAGMDDCLFKPVGLEELERCLCRHMQHEEQREIERCVQEIKQCLGPLTGNQPALMLPLL
FT                   HEFVRASDDDLRGLQQAAEGGELARFLDYVHRLKGGARIMGAMKLVAVCSETESAGIGP
FT                   QGLPRALQPLQHAYGIVRQAIMQMQAEPE"
     atgaggcatt ggtttgcagc tctgctggtc tgttgctgcg cttcatgggc ttcggctcat        60
     gagctggcgg cgccctatct gcatgtctat gcgcgcaatg acagcgagta cctcgagaag       120
     cagaccctgc cgctgcatgc ggaagattgg ctgtggttga gaaatcgtgg ccggctggtg       180
     ctcggggtac ccatgcccga caatcctccg atggacatca ccctgcgtgc caatgcttac       240
     gaaggcgtca ccgccgacat tgtcggcatg ctgagtcatc tgttgcgtgt cgagatcgtc       300
     gtaaagaatc tgccgtctcg cgccgcggcc attgctgcgc tcaagcgggg agaggtcgat       360
     ctgctgagca cctccaatgc ctatgaagaa gagcagcaat tattgttgac cgataaatat       420
     atgccggatg atccggccat atataagaat atacacgtaa aggagcgtga tataagaacg       480
     gtggccgtcc cggagtatta tctgccggcg ctggatgtga tgcgctacct gcccaaggtt       540
     cagataaaaa tgtattcctc tcgttatagc gcactttctg cggttgcata tggccaggtc       600
     gatgccgtca tgctggacat gatttccggg aacttcatcg tcaataaatt ttatcaagac       660
     agcattcaat tactgaaacc gctttatata gatacccatg gtttttcatt ttcgctggaa       720
     agaaaaaatc agcggcttaa aaaaatcatc aatattgcac tggatgaaat tctggaaggc       780
     aagcgggagg aaattgccaa acgctggaat ggcggcggcc tctctatcgg ggccagcaag       840
     gtcgagctga ccagcgagca gtgggcctgg ctgggtcagc agaaaaaaat ccggatggcc       900
     gtcaacagcg gggtgccgcc gctgagtttt ctcgacatca atgacacctt gcacggggtg       960
     gtggccgatt tgctgcaggt gttgcgagcg aagctggggg ttgaaataga ggtggtgcca      1020
     gtcaagacgc cagggcagat gttgcagttg ctggatggtg ggcaggtgga catcgcggtg      1080
     ttgagcccat cggaagagcg tcgcagtcgt tacctgttca gccgtgcctt tgtgctcgac      1140
     ccgctggcct atgtggtggg ggtccgccat gaggcgacgg caccggagac gctgctcaag      1200
     accggtacgg tcgccattat caaggacttc atctccgagc aggcgataga ggaggagtat      1260
     ggcaagctga ccaccagaaa gttcgaacgg atcgaagatg cgctgcgctg cgtggcgagc      1320
     gagacctgcg acgtgaccgt gttgccgttg cgggtcgcca agtactacat caacagcaag      1380
     tttccggaca gtctgctcat cacgggcgag ttgttcgact ccatcccgat cggggcggcg      1440
     tttgccgttt cgcccaagca gcatatgttg cgcgacattc tggatcgggt gattgccatc      1500
     attccgccag atgagctgga ggggctctcc aaccgctggc gcgtcagtac ccagcaggag      1560
     gccatcacct ggcaggagct ggtacgggaa tttggcggca tcattgcctt gatcatgctg      1620
     ctgaccatct ggatcggcct atggggcctc tctttgcaca aacaggtgcg ccagcgccgg      1680
     gcagccgagg tggctttgag tgcccagctc aagttcatcg aagatctggt ggacggcaca      1740
     ccccatccca tctatgccag agatcgagag gaccggctgg tgctctgcaa cagcacttat      1800
     gccagcttct ttggcgagga taagagccgt ctgctgggct ccaccatggc ggaggatgtg      1860
     cagcgttggc cttttctggc tcccttgttc gaggatttga gcaccgcgcg tacggtgcgc      1920
     tgtgccaggc agggggatca tcgtctctcc atggcgacgg ggtccgtggc cgtttatcac      1980
     tgggtacagc cctactatga cctggaggga aatgttcagg gtggaatcgg tggctggata      2040
     gacgtgagcg agcggttgcg gctgctcgaa gagctggccc tggccagtca ggatgcccag      2100
     gaggccaatc gtgccaaatc gacctttctg gccaccatga gccacgagat ccgcacgccc      2160
     atgaatgcca tcattggttt gctggaactg accctgcgcc gcgatcgact gcatgaagag      2220
     gacaagacct cactctccat cgcccatggt tcggccaagg atctgctgag cctgattggc      2280
     gatattttgg atatatccaa gatcgagtcc ggccggcttg aactgaggcc ggagccccat      2340
     gaaatcacgg cgctgacggc ctcggtggtc accgtattca ctgcgctggc tagacaaaag      2400
     aacctgcaac tggaacttgc cgccggcgag ccccgctggg tacagatcga tggcatctgc      2460
     tacaagcaga tcctctccaa tctcatcagc aatgccatca agtacaccga gcagggagcg      2520
     gtgcgggtcg agttgcaatc aaaaaccagc gacggctggt gcaccttgca actggtgatc      2580
     cgggatacgg gcatagggat tgcgcctgcg gagcaagcca ggctgtttca gccttttggt      2640
     caggccaggc agcccgagca catccagcgc tccgggaccg gtctcggact gatgatctcc      2700
     cgctcgctgt gcgagtcgat gggaggctcg ctgctgctgg agagcgagcc tggccacggt      2760
     acgtgcatca gcatcgagat gaaagtgccg ctggcgagcg cggtcgaatc agtcacgccc      2820
     gtggcattgg gcacgatgac agggcatcac cggcgactgc gggtcatgat agtggacgat      2880
     caccccacca accggctgct ggtcagccag caactggcat acctcgggca tgatgccacg      2940
     gcggccgagt cggggcgcga ggcgctggca ctgtttgcca acacaccctt tgacgtgatg      3000
     atcaccgact tcaacatgcc tggcatgagc ggctttgaac tgacccgcca gtatcgggct      3060
     ctggagctga gccggggtac gcatcgttgc ctcatcctgg ggttgacggc ggatgcccgc      3120
     caggagcagg tgagcgaggg gctgaccgcc ggcatggacg actgcctgtt caagccggta      3180
     gggctggaag agctggagcg ctgcctgtgt cgccacatgc agcatgagga gcagcgggaa      3240
     atcgagcgct gtgtgcagga gatcaagcag tgtctcggac cattgaccgg caatcagcct      3300
     gcgctgatgc tgcccttgtt gcatgagttt gtacgggcca gcgacgatga tctgcggggc      3360
     ctgcagcaag ccgcagaagg tggtgaactg gcccgttttc tcgactatgt gcaccgtctg      3420
     aagggtgggg ccaggatcat gggagcgatg aaactggttg ccgtgtgcag cgagacagaa      3480
     tctgccggga ttgggccgca gggattaccg agggcattgc agccgttgca gcatgcctac      3540
     gggatcgtca gacaggccat catgcaaatg caggccgaac cggaatga                   3588
//

If you have problems or comments...

PBIL Back to PBIL home page