(data stored in ACNUC7421 zone)

EMBL: CP000462.PE601

CP000462.PE601       Location/Qualifiers
FT   CDS_pept        complement(669609..669884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0625"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02583"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36974"
FT                   /db_xref="GOA:A0KFY2"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFY2"
FT                   /protein_id="ABK36974.1"
FT                   /translation="MSHTIHGKKKLLARVRRIKGQAGALESALEQESDCAAILQQIAAI
FT                   RGAVNGLMLEVLEGHMREHLGAEEATPAERLEDLDQVVRVLRSYLK"
     atgtcacaca ccattcacgg caagaagaag ctgctggcgc gggtgcgccg catcaagggg        60
     caggcagggg cactggagag cgcgctggag caggagagcg actgcgccgc catcttgcag       120
     cagatcgcgg ccattcgcgg cgccgtcaac ggcctgatgc tggaggtgct ggagggccac       180
     atgcgcgagc atctcggcgc cgaagaggcg accccggccg agcggctgga ggatctggat       240
     caggtggtgc gggtattgcg atcctatctg aagtag                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page