(data stored in ACNUC7421 zone)

EMBL: CP000462.PE602

CP000462.PE602       Location/Qualifiers
FT   CDS_pept        669956..670915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0626"
FT                   /product="heavy metal transporter"
FT                   /note="identified by match to protein family HMM PF01545;
FT                   match to protein family HMM TIGR01297"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35911"
FT                   /db_xref="GOA:A0KFY3"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFY3"
FT                   /protein_id="ABK35911.1"
FT                   /translation="MSSLASSHCHQPVVHEGNPLAEQKTRWAVLLTVIMMVAEIGGGWF
FT                   YNSMALLADGWHMSSHALALGLSVLAYRAARHFARDHRFSFGTWKIEVLGGFTSALLLV
FT                   GVAGMMLFESVFRLLDPSPIHYQQAIVIAIVGLLVNLACAWLLKDDHGHHHGHGHDHHH
FT                   DHHDHAHPHDHGQHHGHQDLNLRAAYIHVLADAATSVLAILALVGGMLWGADWLDPLMG
FT                   IVGAGLVAVWAWGLLRDSGRVLLDAEMDVPLVAEIREVIAELPDAEVRDLHVWRVGQQQ
FT                   YACVLSLLMAAPVAASEIRARLAIHEELVHVTIEVSAA"
     atgtcatccc tcgcctcatc ccactgccac caacccgtcg tccacgaagg gaatccgctg        60
     gccgaacaga agacccgctg ggccgtgctg ctgaccgtca tcatgatggt ggcggagatc       120
     ggcggcggct ggttctacaa ctccatggcg ctgctggccg acggctggca catgagctcc       180
     cacgcgctgg cgctcggcct gtcggtgctg gcctaccgcg ccgcccgcca cttcgcccgc       240
     gaccacagat tcagcttcgg cacctggaag atcgaggtgc tggggggctt taccagcgcc       300
     ctcttgctgg tgggggtggc cggcatgatg ctgttcgagt cggtgttccg gctgctggat       360
     cccagcccga tccactatca acaggccatc gtcatcgcca tcgttggcct gctggtgaac       420
     ctggcctgcg cctggctgct caaggatgac cacggtcatc accatgggca cggtcacgac       480
     caccatcatg atcatcacga ccacgctcac ccgcacgatc atggccagca tcacggtcat       540
     caggatctca acctgcgcgc cgcctacatc cacgtgctgg cggatgcggc cacctcggtg       600
     ctggcgattc tggcgctggt ggggggcatg ttgtgggggg ccgactggct ggatcccctg       660
     atgggcatag tgggggccgg actggttgcg gtgtgggcct ggggcctgct gcgcgactcc       720
     ggccgggtgc tgctggatgc cgagatggac gtgccgctgg tggcggagat ccgcgaggtg       780
     attgccgagt tgccggatgc cgaagtgcgc gatctgcacg tctggcgggt ggggcagcag       840
     caatatgcct gcgtgctctc cctgctgatg gcggcgccgg ttgccgccag cgagatccgc       900
     gcccggctcg ccatccacga ggagctggtg cacgtcacca tagaagtgag cgccgcctga       960
//

If you have problems or comments...

PBIL Back to PBIL home page