(data stored in ACNUC7421 zone)

EMBL: CP000462.PE603

CP000462.PE603       Location/Qualifiers
FT   CDS_pept        complement(670979..671389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0627"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35908"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFY4"
FT                   /protein_id="ABK35908.1"
FT                   /translation="MKRIEEQARRLDQEYQEIAQLFDQFCQQAGTLAEQYHFFNWPDYE
FT                   DTPPLARAFTLLGEPRELRLRCQPGERGSLSGLIQVCGEEGTIHASLGFRADGHLLLES
FT                   GRLLDNPPELLLKLLLGAIWQHKPEDVQGQPH"
     atgaagcgga ttgaagagca ggccagacgg ctggaccagg agtatcaaga gattgcccag        60
     ctgtttgacc aattttgtca gcaggcgggg acgctcgccg agcagtacca cttcttcaac       120
     tggccggatt atgaggatac cccgcccctc gcccgggcct ttaccctgct gggggagcca       180
     cgggagctgc ggctgcgctg ccagccgggg gagcgcggca gtttgagcgg gctgatccag       240
     gtgtgcggcg aggagggcac catccacgcc agcctcggct ttcgggccga cggccacctg       300
     ctgctggagt cgggccggct gctggacaac ccgcccgagc tgctgctcaa actgctgctc       360
     ggcgccatct ggcagcacaa accggaggat gtgcagggcc agccgcactg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page