(data stored in ACNUC7421 zone)

EMBL: CP000462.PE604

CP000462.PE604       Location/Qualifiers
FT   CDS_pept        671620..675708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0628"
FT                   /product="pullulanase"
FT                   /EC_number="3.2.1.41"
FT                   /note="identified by match to protein family HMM PF00128;
FT                   match to protein family HMM PF02922; match to protein
FT                   family HMM TIGR02103"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37551"
FT                   /db_xref="GOA:A0KFY5"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR005323"
FT                   /db_xref="InterPro:IPR011839"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR024561"
FT                   /db_xref="InterPro:IPR040671"
FT                   /db_xref="InterPro:IPR041111"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFY5"
FT                   /protein_id="ABK37551.1"
FT                   /translation="MTGYSDIETNYSGNYKKMDMKKTKVALVTASLLALLSGCNDNSSS
FT                   PSTPDPTDGPVARLPNVQPPAEQLVAGPDQAVIALVDTQTSAARGVTGPFANYSLHLWN
FT                   NDACSATAESGLNAGWDDKVNTPAAADGFGPSWVVPLSKLEGCINFIARNGDLANLTGS
FT                   DMKVVFSDHPDRTVAIVAGKNEIFGSRAEAFTAAFGVAGASAHLIDGNTLIWQGGKDKP
FT                   HVRLYYTESGTIKANAEGVFDFPYITLAPTSLTAEQQAKYPHLKDAAAFALPAGKDLKP
FT                   LLKGELVAIGTDADGILQGATLVQSAGALDALYSEAATKLTYGAVVEGGNVTFRLWAPT
FT                   AKSVKLALFDGQHKPLGERTMTLDEASGSWSVQGGSELVGKFYRYDIQVYHPVSRKLES
FT                   YQVTDPYSLSLAMNSEFSQVVDLNDPALKPEGWDSLKAPHSQQNPADITIYEAHVRDLT
FT                   GNDDSTPAEHRGKFLGLTDTDTAPVKHLQALAKSGVSHLHLLPVFDIATVNEDPAKVAN
FT                   ISDDFGKLCQVNPEVQNSKFAGYCSSGQTIEAVLGDLQGSDSKENPQVQELYGYLRGVD
FT                   SFNWGYDPYHYTTPEGSYATNAEGSQRILEFREMVKAIKQNIGMNVVMDVVYNHTNEAG
FT                   LGPKSVLDKIVPWYYQRLNPETGSVENSTCCSNTAPEHAMFAKLMDDSLVTWARDYKID
FT                   AFRFDLMGHHPKDQMVQALAAVKQVNPEMYFYGEGWNFGEVQDDKRFVQATQKHLAGTG
FT                   IGSFSDRLRDAVRGGSPFDGGDTIRKTQGFGNGALVDANEMDGVDRATALHQADLVRLG
FT                   MAGNLKDFILTDKDGMPKKGSDIDYNGQPAGYAQDPTEIQNYVDKHDNQTLFDNLIYKA
FT                   PQGADLVRMQGVSLATAMLGQGIPFTHAGVELLRSKSMERDSYDSGDWYNRVDYTLADN
FT                   NFDKGLPRKDKDGDNYPLIEKVLGKHVKPSGADMATMVGFYQELAELRQSSRLLRLGSG
FT                   AEVIKRVDFRNTGPDQEPGLIVMTVDDGINAGADLDPAIDGLVVMINATNAPQSISDFR
FT                   DGNDQPIDLTSLQLSPAHHGGESIARDAAANGGTLTLGAWSAAVFVKPQSGAQGTGLPV
FT                   GKKTDLSTVPPFGDTAVYLKGFLNEWGNTNQMTFSSNFMYEFTTEVSSDKLGTTNVKIA
FT                   DASWGPLNYGSCNAGDKLVVGTPLTLCKGGDTGNIGLDLAKAGSYKFVFTAMNKDKPTL
FT                   SVSFTEPVQSCKVLDTVAGNPLGYNLFVKGELSGWAAQPQYQLSYKGMDGDLAIYQAAF
FT                   NYTGSTEFKVANEDWSKEYLLNGGGAVTAETGYAIGFSQPGSANNSITLPQGLWSVLVK
FT                   VDPAGTKAGTAVIQECSAK"
     atgaccgggt actcggatat cgagactaac tacagcggga attataaaaa aatggatatg        60
     aaaaagacca aagtggcgct ggtaacagcc tcactgctcg cgcttttgtc cggctgcaat       120
     gacaacagct cctccccctc cacccctgac cccacggacg gccccgtcgc ccgtctgccc       180
     aatgtgcaac cccctgccga gcaactggta gccgggcccg atcaggcggt gatcgccctg       240
     gtggataccc agaccagtgc ggctcgcggg gtcactggcc ccttcgccaa ctacagcctg       300
     cacctgtgga acaacgacgc ctgcagcgcc accgccgaga gcggcctcaa cgcaggctgg       360
     gacgacaagg tcaacacccc ggccgcggcc gacggcttcg gcccgagctg ggtggtgccc       420
     cttagcaagc tggaaggctg catcaacttc atcgcccgca acggcgatct ggccaacctg       480
     accggcagcg acatgaaggt ggtcttcagc gatcacccgg accgcaccgt ggccatcgtc       540
     gccggcaaga acgagatctt cggcagccgc gccgaggcct tcaccgccgc cttcggcgtg       600
     gcgggcgcca gtgcccacct gatcgacggc aacaccctga tctggcaagg gggcaaggac       660
     aagccccatg tgcgcctcta ttacaccgag tccggcacca tcaaggccaa tgccgaaggg       720
     gtgttcgact tcccctacat cacccttgct ccgaccagcc tgaccgccga gcagcaggcc       780
     aagtatccgc atctgaagga tgccgccgcc ttcgccctgc cggctggtaa agatctcaag       840
     ccgctgctca agggtgagct ggtggccatc ggcaccgatg ccgacggcat tctgcagggg       900
     gcgaccctgg tgcagagcgc cggcgccctc gatgccctct acagcgaagc ggctaccaag       960
     ctgacttatg gcgccgtggt cgaggggggc aatgtcacct tccggctgtg ggcgccgacc      1020
     gccaagtcgg tcaagctggc gctgttcgac ggccagcaca agccgctcgg cgagcgcacc      1080
     atgaccctgg acgaggccag cggcagctgg agcgtgcagg gcggcagcga gctggtgggc      1140
     aagttctacc gctacgacat ccaggtctat cacccggtca gccgcaagct ggaatcctat      1200
     caggtgaccg acccctactc cctgagcctg gcgatgaact ccgagttcag ccaggtggtg      1260
     gatctcaacg atccggctct caagccggaa gggtgggaca gcctcaaggc gccccacagc      1320
     cagcagaacc ccgccgacat caccatctat gaggcccatg tccgcgatct gaccggcaac      1380
     gacgactcca ccccggccga gcaccgcggc aagttcctcg gcctgaccga taccgacacg      1440
     gcgccggtca agcacctgca ggcactggcc aagagcggcg tcagccacct gcacctgctg      1500
     ccggtgttcg acatcgccac cgtcaacgag gatccggcca aggtcgccaa catcagcgac      1560
     gattttggca agctgtgcca ggtcaacccc gaggtgcaga actccaagtt cgccggctac      1620
     tgcagcagcg gccagaccat cgaggccgtg ctcggcgatc tgcaagggag cgacagcaag      1680
     gagaacccgc aggtgcagga gctctacggc tatctgcgcg gcgtcgactc cttcaactgg      1740
     ggctatgacc cttaccacta caccaccccg gaaggctcct acgccaccaa cgccgagggc      1800
     agccagcgca tcctggagtt ccgcgaaatg gtcaaggcca tcaagcagaa catcggcatg      1860
     aacgtggtga tggacgtggt ctacaaccac accaacgagg cgggcctggg gcccaagtcg      1920
     gtgctcgaca agatagtgcc ctggtactat cagcgcctca atccggagac cggctcggtg      1980
     gagaactcca cctgctgctc caacacggcg ccggaacacg ccatgttcgc caagctgatg      2040
     gatgactccc tggtcacctg ggcgcgcgac tacaagatcg acgccttccg cttcgacctg      2100
     atgggccacc acccgaaaga tcagatggtg caggcgctgg ctgcggtgaa gcaggtcaac      2160
     ccggagatgt acttctacgg cgagggctgg aacttcggcg aggtgcagga tgacaagcgc      2220
     ttcgtgcagg cgacccagaa acacctggcc ggcaccggca tcggctcctt ctccgaccgg      2280
     ctgcgggatg cggtgcgcgg cggcagtccg ttcgacggcg gcgacacgat tcgcaagacc      2340
     cagggctttg gcaacggcgc tctggtggat gccaacgaga tggatggcgt agatcgcgcc      2400
     accgctctgc atcaggccga tctggtgcgc ctcggcatgg ccggcaacct caaggacttc      2460
     atcctgaccg acaaggatgg catgccgaag aagggctccg acatcgacta caacggtcaa      2520
     ccggcgggct acgcccagga tccgaccgaa atccagaact acgtcgacaa gcacgacaac      2580
     cagaccctgt tcgacaacct gatctacaag gcgccgcaag gggccgatct ggtgcggatg      2640
     cagggggtat cgctcgccac tgccatgctg gggcagggca ttcccttcac ccatgccggt      2700
     gtcgagctgc tgcgctccaa gtccatggag cgggacagct acgactcggg tgactggtac      2760
     aaccgggtcg actataccct ggccgacaac aacttcgaca aggggctgcc gcgcaaggac      2820
     aaggatggcg acaactatcc gctgatcgag aaagtactcg gcaagcacgt caagccgagc      2880
     ggtgccgaca tggcgaccat ggtgggcttc tatcaggagc tggccgagct gcgtcaatcc      2940
     tcccgtctgc tgcgtctggg cagcggtgcc gaggtgatca agcgggtcga cttccgcaat      3000
     accggcccgg atcaggagcc cggcctcatc gtgatgacgg tggatgacgg catcaatgcg      3060
     ggggcggatc tggatccggc catcgacggt ctggtggtga tgatcaacgc caccaatgct      3120
     ccccagagca tcagcgactt ccgtgacggc aacgatcagc ccatcgatct gaccagcctg      3180
     cagctgagcc cggctcacca cggcggcgag agcatcgccc gcgatgcggc cgccaatggc      3240
     ggtaccctga ccctgggtgc ctggtcggcg gcggtgttcg tcaagccgca gagcggtgcc      3300
     cagggcactg gcctgccggt tggcaagaag actgatctga gcacggtacc gccgttcggt      3360
     gacaccgccg tctatctgaa ggggttcctc aatgaatggg gcaacaccaa ccagatgacc      3420
     ttcagcagca acttcatgta cgagttcacc accgaggtga gcagcgacaa gctgggcacc      3480
     accaacgtca agatcgcgga tgccagctgg ggtcccctca actacggcag ctgcaatgcg      3540
     ggtgacaagc tggtggtcgg cactccgttg accctttgca agggcggcga taccggcaac      3600
     atcgggctcg atctggccaa ggcgggcagc tacaagttcg tgttcaccgc catgaacaag      3660
     gacaagccca ccctgagcgt cagcttcacc gagccggtgc agagctgcaa ggtgctggac      3720
     acggtggcgg gcaatccgct cggctacaac ctgttcgtca agggcgaact ctccggctgg      3780
     gccgctcagc cccagtacca gttgagctac aaggggatgg acggcgatct ggccatctat      3840
     caggcggcct tcaactacac cggcagcacc gagttcaagg tggccaacga ggactggagc      3900
     aaggagtacc tgctcaacgg cggcggtgcg gtgacggcgg agacgggtta tgccatcggc      3960
     ttctcccagc cgggcagcgc caacaacagc atcaccttgc cgcagggcct gtggagcgtg      4020
     ctggtgaagg ttgacccggc cggcaccaag gccggtaccg ctgtgatcca ggagtgcagc      4080
     gccaagtag                                                              4089
//

If you have problems or comments...

PBIL Back to PBIL home page