(data stored in ACNUC7421 zone)

EMBL: CP000462.PE61

CP000462.PE61        Location/Qualifiers
FT   CDS_pept        complement(72586..73026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0065"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37460"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEB3"
FT                   /protein_id="ABK37460.1"
FT                   /translation="MSQKGVLVALLAGCCAIAAQAGTQTYQLNWPATASKSTGMEISLT
FT                   HPGQQPVNSVSTSSPVQTEAINLSNPDFNTTYQLQARTLYASLPEQAGTDFKLVLNGQP
FT                   LPQHHALPLTQATRYFLSYLAPAAKPDQTGEAAYELLVYWHG"
     atgtctcaga aaggagttct ggtggcacta ctggctggtt gctgcgcgat agcggctcag        60
     gccggcacgc aaacctatca gctcaattgg cctgccaccg ccagcaagag caccgggatg       120
     gaaatctcgc tcacccaccc aggccagcaa ccggtcaatt ccgtttccac ctccagcccg       180
     gtccagaccg aggccatcaa cctcagcaat ccggacttca acaccaccta tcaattgcag       240
     gctcgcaccc tgtatgccag tttgcccgaa caagctggca ccgacttcaa gctggtcctc       300
     aacggccagc cactgccaca acaccatgcc ctgcctctga cccaggccac ccgctacttc       360
     ctcagctatc tggctccggc cgccaaaccg gaccagaccg gtgaagcggc ctatgaactg       420
     ctggtctact ggcacggttg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page