(data stored in ACNUC7421 zone)

EMBL: CP000462.PE63

CP000462.PE63        Location/Qualifiers
FT   CDS_pept        75002..75733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0067"
FT                   /product="response regulator receiver domain"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF04397"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38388"
FT                   /db_xref="GOA:A0KEB6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEB6"
FT                   /protein_id="ABK38388.1"
FT                   /translation="MLKAIIVEDEYLAREELAYLVGQHSTIEIVASFEDGLEAFKYLQD
FT                   HEVDVVFLDIQIPSIDGLLLAKNLHKSSHPPHIVFVTAYKEFAVEAFELEAFDYILKPY
FT                   NEPRLISLLQKLELAGKSQTGQGSEPGTPHNRTVNLVKGERIIVTPCEQIYYAEADEKL
FT                   TYVYTRDDRYVMTMTLSEFVSRLPAEGFFRCHRSYCVNINKIREIVPWFNSTYLIRLHD
FT                   LPFEVPVSRSNIKAFRQLMRL"
     atgctgaaag ccatcatagt ggaagacgag tatctggccc gggaagagct ggcctacctg        60
     gtggggcagc acagcaccat cgagatagtg gcgagcttcg aggacgggct ggaggcgttc       120
     aaatacctgc aggatcacga ggtggacgtg gtctttctcg acatccagat cccctccatc       180
     gacggcctgc tgctggccaa gaacctgcac aagtcgagcc atccgcccca catcgtcttc       240
     gtcaccgcct acaaggagtt tgcggtggag gcgttcgagc tggaggcgtt cgactacatc       300
     ctcaaaccct acaacgagcc gcgcctcatc agcctgctgc aaaagctgga actggcgggc       360
     aagtcgcaga cggggcaggg gagcgagccg ggcacgccgc acaatcgcac cgtcaatctg       420
     gtgaaggggg agcgcatcat cgtcaccccc tgcgaacaga tctactacgc ggaagccgac       480
     gagaagctca cttatgtcta cacccgcgat gatcgctacg tgatgaccat gaccctcagc       540
     gagttcgtca gccggctgcc tgccgagggg ttcttccgtt gccaccgctc ctactgcgtc       600
     aacatcaaca agatccgcga gatagtgccc tggttcaaca gcacctatct catccggctc       660
     catgacctgc cgttcgaggt gccggtcagc cgcagcaaca tcaaggcgtt ccgtcagctg       720
     atgcggctct ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page