(data stored in ACNUC7421 zone)

EMBL: CP000462.PE7

CP000462.PE7         Location/Qualifiers
FT   CDS_pept        7792..8205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0007"
FT                   /product="16 kDa heat shock protein A"
FT                   /note="identified by match to protein family HMM PF00011"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37772"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEA5"
FT                   /protein_id="ABK37772.1"
FT                   /translation="MRSIDFSPLYRSAIGFDRLANLIESAASNGNAGYPPYNIEQLGDS
FT                   DYRISMAVAGFTQEELELSFQENLLTVKGNKQADTERNYLYQGIAERGFERRFQLADYV
FT                   RVKGADLKNGLLHIDLVREVPEAMKPRKIEING"
     atgcgttcta tcgacttttc tccgctctat cgttctgcca tcggtttcga tcgtctggcc        60
     aatctcatcg aatctgcggc cagcaatggc aatgccggtt atccccccta caacatcgag       120
     cagctgggtg acagcgacta ccgcatcagc atggcggtgg cgggctttac ccaggaagag       180
     ctggagctga gcttccagga aaatctgctg acggtgaagg gcaacaagca ggccgatacc       240
     gagcgcaact acctctacca aggcatagcc gaacgcggtt tcgagcgtcg cttccagctg       300
     gctgactatg tgcgggtgaa gggggccgat ctgaaaaacg gtctgcttca catcgacctg       360
     gtgcgcgaag tgcccgaggc gatgaagccc cgcaagatcg agatcaacgg ctga             414
//

If you have problems or comments...

PBIL Back to PBIL home page