(data stored in ACNUC7421 zone)

EMBL: CP000462.PE70

CP000462.PE70        Location/Qualifiers
FT   CDS_pept        81312..83147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0074"
FT                   /product="vitamin B12 transporter BtuB"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39619"
FT                   /db_xref="GOA:A0KEE6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010101"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEE6"
FT                   /protein_id="ABK39619.1"
FT                   /translation="MSKKLLAAALLPTAAFAQTTIPVNPTLVITANRVEQPISSVLAPV
FT                   VVIDRAEIESRQVQSLPALLKTLPGVQITTLGGRGHMSSLFIRGTNSNHSLVLMNGRPI
FT                   AAMVAGTPDLSQIPLGNIERIEYIRGPRAAVYGSDAIGGVINLITKTSAKNGSETHLKG
FT                   GVGSNGYGQGQLRTVQALGQQTDMNMMIGYERTDGFDVVANAQQPDRDGFDSLNGQFGL
FT                   SHAFNDAWSADFNAQGYDNQTEMDDAYQSADQSRVQAFQYDGGLKYQSGALSSRLEASY
FT                   GENKLKSWLESKGESSAEPIHTGLTRFSWINSWSGVEGLNLTGGADWQQEQLKSDTRSY
FT                   GQAFNAPDRDNTGLFVVGSYRWQALLWELSGRTDDNKQYGRHNTWSAASGLDLDDNHNV
FT                   RLSYGTAFKAPTFLDLYYPGYENPALKPEESKNLELGFSGRYTGWDWSLNLYRNQIQNL
FT                   IACQSASSTCRPDNTDAEIRGVEVALGLETGPLRHDLSFDYTRAEDKNDGDQQLLRRAK
FT                   QKASWLTQVQLGPVDLSTELLYVGKRDDKNFSSFPAERVELGSYTLINLGASYGVTPQF
FT                   TLGGRIDNLFDRDYAPAYGYASAGTEFKLTADYRL"
     atgtccaaga aattattggc ggctgccctg ttgccaacgg cggccttcgc ccagaccacc        60
     atccccgtca atcctaccct ggtcatcacc gccaatcggg tggagcaacc catcagctcg       120
     gtactggctc ccgttgtggt gatcgatcgc gccgagatcg aatcccgtca ggtgcagagc       180
     ctgccagcgt tgctgaagac gctgcccggc gtgcagatca ctaccctggg tggccgaggc       240
     cacatgagca gcctgttcat ccgtggtacc aactccaacc attcactggt gctgatgaat       300
     gggcgcccca tcgcggccat ggtggctggc acgccggatc tcagccagat cccgctcggt       360
     aatatcgaac gcatcgagta catccgtggc ccgcgggcgg ccgtgtatgg ctcggacgcc       420
     atcggcggcg tcatcaatct gatcaccaag acatccgcca agaatggcag cgagacccac       480
     ctgaaaggcg gtgtgggcag caatggttac ggccagggcc agctgcgtac cgtgcaggct       540
     ctgggccagc agaccgacat gaatatgatg atcggctacg agcgcaccga tgggttcgac       600
     gtggtggcca atgcccagca gccggatcgg gatggctttg acagcttgaa cggccagttc       660
     ggactgagtc atgctttcaa cgacgcatgg agtgccgact tcaacgccca gggctatgac       720
     aaccagaccg aaatggatga tgcgtatcag tcggccgatc agagccgggt gcaggcgttc       780
     cagtacgatg gcggtctcaa gtatcagagt ggcgcgctga gcagccggct ggaggccagc       840
     tacggtgaga acaagctgaa gagctggctg gagagcaaag gggagtccag tgcggagccc       900
     atccacaccg ggctgacccg cttctcctgg atcaacagct ggagtggtgt cgaggggcta       960
     aacctgaccg gtggtgccga ctggcagcag gagcagctga aatccgatac acgcagctat      1020
     ggtcaggcat tcaatgcccc ggatcgcgac aacacgggtc tgttcgtggt gggcagctac      1080
     cgctggcagg ccctgctgtg ggaactctct ggtcgtaccg atgacaacaa gcaatatggc      1140
     cgccacaaca cctggtccgc tgccagcggg ctggatctcg atgacaacca taatgtgcgt      1200
     ctgagctatg gcactgcctt caaggcaccg accttcctcg atctctacta tccgggttat      1260
     gagaaccccg cgctgaaacc ggaagagagc aagaacctgg agctgggctt cagcggccgc      1320
     tacaccggtt gggattggtc gttgaacctc taccgcaacc agatccagaa tctgattgcc      1380
     tgccaaagcg cgtcctcaac ctgccgaccg gacaacaccg acgccgagat ccgcggtgtg      1440
     gaagtggcgc tcggtctgga aaccggacca ctgcggcacg acctgagctt tgactacacc      1500
     cgggccgaag acaagaacga tggggatcag caactgctgc gtcgtgccaa gcagaaggcc      1560
     agctggctga ctcaggtgca actgggcccg gtcgatctct ctaccgaact gctttatgtc      1620
     ggcaaacggg atgacaagaa cttcagcagc ttcccggcgg agcgggttga gctgggttcc      1680
     tacaccctga tcaacttggg ggcgagctat ggggtgacgc ctcagttcac gctgggtggc      1740
     cgcatcgaca acctgtttga tcgtgattac gccccggcct atggctatgc gtcggcaggt      1800
     accgagttca agctgacggc ggactaccgt ctctga                                1836
//

If you have problems or comments...

PBIL Back to PBIL home page