(data stored in ACNUC7421 zone)

EMBL: CP000462.PE72

CP000462.PE72        Location/Qualifiers
FT   CDS_pept        complement(84078..84569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0076"
FT                   /product="RNA-binding protein"
FT                   /note="identified by match to protein family HMM PF00076"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38944"
FT                   /db_xref="GOA:A0KEF3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEF3"
FT                   /protein_id="ABK38944.1"
FT                   /translation="MNLSKFPVYVQAAILALVLALVGYLVAQALQFSLKAEVIFAVGLA
FT                   IGGFVVPLFLNRAPAGVAELASSQETCTLYVGNLPYRANEIAVRELFAEQGQVISVRLM
FT                   KDKATGKRRGFGFVEMPAADAAKAIAALNDKEYQQRTLKVREANDKRDKDEREGSEVDA
FT                   "
     atgaatttat ccaagtttcc cgtttatgtg caggcggcca tccttgctct ggtgttggcg        60
     ctggttggtt atctggttgc ccaggccctg caattttctt tgaaagccga agtgattttt       120
     gctgtgggct tggccatcgg cggtttcgtg gtaccgctgt tcctgaaccg tgcaccggcg       180
     ggtgtggctg aactggcctc cagtcaggag acctgcacct tatatgtagg caatctgcca       240
     taccgtgcca atgagatagc cgtgcgcgaa ttgtttgccg agcagggcca ggtgatctcg       300
     gtccgtctga tgaaggacaa ggccaccggc aagcgcagag gattcggttt cgtggagatg       360
     cccgctgctg atgccgccaa ggcgatcgcc gcactcaacg acaaggagta tcaacagcgt       420
     acccttaaag tacgtgaagc caacgacaag cgggacaaag atgagcgaga aggcagtgaa       480
     gtggatgcct ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page