(data stored in ACNUC7421 zone)

EMBL: CP000462.PE75

CP000462.PE75        Location/Qualifiers
FT   CDS_pept        92756..93508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0084"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase UbiE"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01209;
FT                   match to protein family HMM TIGR01934"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36304"
FT                   /db_xref="GOA:A0KEF6"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEF6"
FT                   /protein_id="ABK36304.1"
FT                   /translation="MSEQTTTTHFGFKTVASTEKETLVAGVFHSVAAKYDLMNDLMSFG
FT                   IHRLWKRFTIDCSGVRKGQKVLDLAGGTGDLTAKFSRIVGETGQVVLADINDSMLKVGR
FT                   DKLRNLGVANNVSYVQANAEALPFPDNHFDVITIGFGLRNVTDKDKALASMFRVLKPGG
FT                   RLLVLEFSKPVSEVIAKLYDLYSFKLLPKMGEIVANDSESYKYLAESIRMHPDQQTLAG
FT                   MMENVGFEQVEFYNLTQGVVALHRGYKF"
     atgtcagaac agactacgac aacgcatttt ggctttaaaa ccgtggcctc gaccgagaag        60
     gaaaccctgg tcgccggcgt cttccattcg gtggcagcca agtatgatct gatgaacgat       120
     ctgatgtcgt tcggcatcca ccgcctgtgg aagcgcttca ccatcgactg ctccggcgta       180
     cgcaagggtc agaaggtgct ggatctggcc ggtggtaccg gcgatctgac cgccaagttc       240
     tcccgcatcg tcggcgagac cggccaggtg gtgctggcgg atatcaacga ctccatgctc       300
     aaggtgggcc gtgacaagct gcgcaatctg ggggtggcca acaacgtctc ctacgtacag       360
     gccaatgccg aggcgctccc gttccctgac aaccatttcg acgtaatcac catcggcttc       420
     ggcctgcgca acgtcaccga caaggacaag gcgctcgcct ccatgttccg ggtgctcaag       480
     ccgggtggcc gcctgctggt gctggagttc tccaagccgg tcagcgaagt gatcgccaag       540
     ctgtacgatc tctactcctt caaactgctg ccgaaaatgg gcgaaatcgt cgcgaacgac       600
     agcgaaagct acaaatacct ggcggaatcg atccgcatgc acccggatca gcagaccctg       660
     gcaggcatga tggagaatgt cggtttcgag caggtcgagt tttacaacct gacccagggc       720
     gtggtcgccc tgcaccgcgg ttacaagttt taa                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page