(data stored in ACNUC7421 zone)

EMBL: CP000462.PE8

CP000462.PE8         Location/Qualifiers
FT   CDS_pept        8298..8735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0008"
FT                   /product="16 kDa heat shock protein A"
FT                   /note="identified by match to protein family HMM PF00011"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38558"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEA7"
FT                   /protein_id="ABK38558.1"
FT                   /translation="MRNLDFSHLYSNAVGFERMARELEGLFEQKTAAYPPYNIEKRDQD
FT                   GYRITVAVAGFEREELELETENGTLKVKGRKAATDERQFLHQGIAERDFELAFKLSQHV
FT                   EVQGAKLEHGLLTIDLARELPEALKPRAIPIGKPEQLALPG"
     atgcgtaacc tcgatttttc tcatctctat tccaacgccg tcggcttcga gcggatggcc        60
     cgtgagctgg aaggtctgtt cgagcagaag accgccgctt accccccgta caacatcgaa       120
     aagcgcgatc aggacggcta tcgcatcacg gttgccgtgg ctggcttcga gcgcgaagag       180
     ctggagctgg agaccgaaaa cggcaccctc aaggtgaagg ggcgcaaggc cgccaccgat       240
     gagcgccagt tcctccatca ggggatcgcc gagcgcgact tcgagctcgc cttcaagctg       300
     agccagcacg tggaagtgca gggcgccaag ctggagcatg ggctgctgac catcgatctg       360
     gcacgcgagc tgccagaggc gctcaagccc cgtgccatcc ccatcggcaa gcccgagcag       420
     ctggcactgc ccggttaa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page