(data stored in ACNUC7421 zone)

EMBL: CP000462.PE81

CP000462.PE81        Location/Qualifiers
FT   CDS_pept        97365..98150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0090"
FT                   /product="deoxyribonuclease TatD"
FT                   /EC_number="3.1.21.-"
FT                   /note="identified by match to protein family HMM PF01026"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38917"
FT                   /db_xref="GOA:A0KEG2"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEG2"
FT                   /protein_id="ABK38917.1"
FT                   /translation="MIDIGVNLTSSQFADEQADLVARARAVGVEALILTGTDLVGSRES
FT                   ATLAARWPGYCFSTAGVHPHDAKSVDEATLPALRELAALPQVVAIGECGLDYNRDFSPR
FT                   PVQDAVFDAQLALAAELGMPVFLHCRDAHARFIEILRPWLPKLPGAVLHCFTGSDEELD
FT                   QCLALGLHIGVTGWLCDERRGQLLREQVARIPAGRLMIETDAPYLVPRDLKPRPKRNEP
FT                   AFLPHIAQVVAACRGEAPEALLAHTRATSAAFFQLPLQE"
     atgatcgaca taggtgtaaa cctgaccagc agccagtttg ccgatgaaca ggccgatctg        60
     gtggcccgcg cccgcgccgt cggggtggag gcgctgatct tgaccggcac cgatctggtc       120
     ggcagccgcg agagcgctac ccttgccgcc cgctggccgg gttactgttt ctccaccgcc       180
     ggggtccacc cccacgatgc caaaagcgtc gatgaggcga ccctgcccgc cctgcgcgag       240
     ctggcagcct tgccgcaggt ggtggccatc ggcgagtgcg ggctcgacta caatcgtgac       300
     ttctcgcccc gtccggtgca ggacgcggta ttcgacgccc agctggcgct ggccgccgag       360
     ctcgggatgc cggtgtttct ccactgccgc gatgctcacg cccgtttcat cgagatcctg       420
     cgcccctggt tacccaagct gccgggggcc gtgctgcact gcttcaccgg ctccgacgag       480
     gagctggacc agtgtctggc gctggggctg catatcgggg tgaccggctg gctgtgcgac       540
     gagcgtcgcg gccagttgct gcgcgagcag gtggcccgca ttccggcagg ccggctgatg       600
     atcgagaccg atgcccccta tctggtgcca cgggatctga agcccagacc aaaacgcaac       660
     gaacccgctt ttttgccgca catcgcccag gtggtggcgg cctgccgtgg tgaagcgccc       720
     gaggccttgc tggcccacac ccgggccacc tccgccgcgt tcttccaact tcctcttcag       780
     gagtga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page