(data stored in ACNUC7421 zone)

EMBL: CP000462.PE85

CP000462.PE85        Location/Qualifiers
FT   CDS_pept        104281..105027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0094"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04445"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36028"
FT                   /db_xref="GOA:A0KEG6"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEG6"
FT                   /protein_id="ABK36028.1"
FT                   /translation="MQILLEDPAKAPQAEALASQLGQTDLPQFALVFTAARLELRKLDE
FT                   PKLGAVYVDFVEGAVAHRRKFGGGRGQSIAKAVGLKAGAMPRVVDATAGLGRDAFVLAS
FT                   LGCKVTMIERSPVVAALLQDGLARAALDPEIGPWVRERMQLRHGPAVETLLGLTERPDV
FT                   IYLDPMFPHKQKSALVKKEMRVFQSLVGPDLDADALLPAALAMADKRVVVKRPDYAGWL
FT                   NEHKPSMAIETKSNRFDVYVMAALAG"
     atgcagatcc tcctcgaaga ccccgccaag gcgccccagg ccgaagccct ggccagccag        60
     ctcggccaga ccgaccttcc ccagtttgcc ctggtgttca ccgcggcgcg gctggagctg       120
     cgcaagctgg acgagcccaa gctgggtgcg gtctacgtgg acttcgtcga aggggcggtc       180
     gcccatcgcc gcaagttcgg cggtggccgt ggccaatcca tcgccaaggc ggtggggctc       240
     aaggcgggtg ccatgccgcg ggtggtggat gccaccgccg ggctgggacg cgatgccttc       300
     gtgctcgcct ccctcggctg caaggtgacc atgatcgagc gcagccccgt ggtggccgcc       360
     ctgttgcagg acgggctggc gcgggcggcg ctggacccgg agatcggccc ctgggtacgc       420
     gagcggatgc agctgcggca cggcccggcg gtggagacct tgctggggtt gaccgagcgg       480
     cccgacgtca tctacctcga ccccatgttc ccccacaagc agaagtcggc gctggtgaaa       540
     aaagagatgc gggtgttcca gtcgctggtg ggaccggatc tcgacgccga tgccctgctg       600
     ccggcggcgc tcgccatggc ggacaagcgg gtggtggtga aacggccgga ctacgccggc       660
     tggctcaacg agcacaagcc gagcatggct atcgagacca agagcaaccg cttcgatgtc       720
     tacgtgatgg cggcgctggc gggataa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page