(data stored in ACNUC7421 zone)

EMBL: CP000462.PE86

CP000462.PE86        Location/Qualifiers
FT   CDS_pept        complement(105382..106371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0095"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36472"
FT                   /db_xref="InterPro:IPR025491"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEG7"
FT                   /protein_id="ABK36472.1"
FT                   /translation="MDAMKPLTLIGLTALLTACGGGGGGDNNSPQQAQLSLAFSDAPVD
FT                   AVSKVCIAVANISIHPVAGTEQSWTTASFLTSTQDDGCTPSGETIPLDSAGRPLFTYID
FT                   LLHYQGSVSRPLLASQSVEPGDYSQMRLRVLDGREVANQFLDGTPYSYVKRDDGVIKPL
FT                   EVPSSELKLDAFTIAANGLSAFTTEFDLRQAMVLPGHEQYYKLKPRGVRLVNNTQVTTV
FT                   KGTVAAGLCGGQLTDKAFVYFYQPRSDDNYPDMADSDNGFYASAPVLPQSGGGFGYELG
FT                   FVNLGSYDLALVCNGNEDDPALAGDPLQLEQVQQAQAVVAPATSINFQ"
     atggacgcca tgaaaccctt gaccctgatc ggcctgaccg ccttgcttac cgcctgcggg        60
     ggcggaggcg gcggcgacaa caacagcccg caacaggccc agctctcgct ggccttctcc       120
     gacgccccgg tggatgcagt cagcaaggtc tgcatcgccg tcgccaacat cagcatccac       180
     cccgtcgccg gcaccgagca gagctggacc actgccagtt ttctcacctc gacccaggac       240
     gatggctgca ccccgagcgg cgagaccatc ccgctcgaca gtgcgggccg gccgctgttc       300
     acctacatag acctgctgca ctatcagggt tcggtcagcc gcccgctgct ggccagccag       360
     agcgtggagc ccggcgacta cagccagatg cggctgcggg tgctggacgg acgagaggtt       420
     gccaaccagt ttctggatgg caccccctac tcctacgtca aacgggatga tggggtgatc       480
     aagccgctgg aggtgcccag cagcgaactc aagctggatg ccttcaccat cgccgccaac       540
     ggcctcagcg ccttcaccac cgagttcgat ctgcgccagg ccatggtgct gccgggccac       600
     gagcagtact acaagctcaa gcccagaggg gtgcggctgg tgaacaacac ccaggtcacc       660
     acagtcaagg gcacggtcgc ggccgggctg tgcggtggcc agctgaccga caaggccttc       720
     gtctacttct accagcccag aagcgatgac aactaccccg acatggcgga cagcgacaac       780
     ggcttctatg ccagcgcacc cgtgttgccg caaagcggtg gcggctttgg ttacgaactg       840
     ggatttgtta atctcggcag ctacgatctg gcgctggtct gcaatggcaa cgaggacgat       900
     ccggcgctgg ccggcgaccc gctgcaactg gaacaggtgc agcaagccca agcggtggtg       960
     gcgcccgcca ccagcatcaa cttccagtaa                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page