(data stored in ACNUC7421 zone)

EMBL: CP000462.PE9

CP000462.PE9         Location/Qualifiers
FT   CDS_pept        complement(8809..10059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0009"
FT                   /product="valine--pyruvate aminotransferase"
FT                   /EC_number="2.6.1.66"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38117"
FT                   /db_xref="GOA:A0KEA8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEA8"
FT                   /protein_id="ABK38117.1"
FT                   /translation="MEFSLFGEKFTRHAGITQLMDDLNQGLTNPDAIMLGGGNPAPIPA
FT                   MLERFQAEAKSLLDNGELVKAMANYDGPQGKDRFTKALAALLSKELGWDISARNIALTN
FT                   GSQNAFFYLFNLLAGEFADGRKKKVLFPLAPEYIGYADSALADDYFVAYKPTIEKLADG
FT                   QFKYHVDFESLQVGDDIGVICVSRPTNPTGNVLTDEEIEHLDQIARDKGIPLLIDNAYG
FT                   VPFPGIIFSEAKPFWNANTILCMSLSKLGLPGTRCGIVIADEKIIQAITNLSGIINLAP
FT                   GSLGPAITIPMIESGEIIALSEQVVKPFYRQKAELAVQLLREAIPDPRFHIHKPEGALF
FT                   LWLWFEGLPIHCQELYERLKAKNLLIVPGHYFFPGIDDPEWRHSQECIRLNYSQSEELV
FT                   RRGIAILADEINALYAG"
     atggaatttt ccttgttcgg cgagaagttc actcgccatg ccggtattac ccaactcatg        60
     gatgacctta atcaggggct gaccaatccg gacgccatca tgctgggtgg cggcaacccg       120
     gcccccatcc ccgccatgct ggaacgcttc caggccgagg ccaagagcct gctcgacaac       180
     ggtgagctgg tgaaggcgat ggccaactac gatggccccc agggcaagga caggtttacc       240
     aaggcgctgg cggccctgct cagcaaggag ctgggctggg acatctctgc ccgcaatatc       300
     gccctgacca acggcagcca gaacgccttc ttctatctgt tcaacctgct ggcgggcgaa       360
     tttgccgatg gccgcaagaa gaaggtgctg ttcccgctcg cccccgagta catcggctat       420
     gccgactcgg cactggcgga cgactacttc gtggcctaca agcccaccat agagaagctg       480
     gccgacggcc agttcaagta ccacgtggac ttcgagagcc tgcaggtggg tgacgacatc       540
     ggggtgatct gcgtctcccg ccccaccaac cccaccggca acgtgctgac cgatgaagag       600
     atcgaacacc tcgatcagat tgcccgcgac aagggcattc cactgctgat cgacaacgcc       660
     tacggcgtcc ccttcccggg catcatcttc agcgaggcca agccgttctg gaacgccaat       720
     accatcctct gcatgagtct ctccaagctc ggcctgccgg gcactcgctg cggcatcgtc       780
     atcgccgacg agaagatcat tcaggccatc accaacctga gcggtatcat caatctggcg       840
     ccgggcagtc tggggcccgc catcaccatt ccgatgatcg agagcggtga gatcatcgcc       900
     ctcagcgagc aggtggtgaa acccttctat aggcagaagg cggagctggc ggtgcaactg       960
     ctgcgcgagg cgatcccgga tccccgcttc cacatccaca agccggaagg cgccctcttc      1020
     ctctggctct ggttcgaagg cctgccgatc cactgtcagg agctgtacga gcgactgaag      1080
     gcgaagaacc tgctgatcgt gccgggccac tacttcttcc ccggcattga cgacccagag      1140
     tggcgccaca gccaggagtg tatccgcctc aactactccc agagcgagga gctggtgcgg      1200
     cgcggcatcg ccatcctggc cgacgagatc aacgccctct acgccggcta a               1251
//

If you have problems or comments...

PBIL Back to PBIL home page