(data stored in ACNUC7421 zone)

EMBL: CP000462.PE94

CP000462.PE94        Location/Qualifiers
FT   CDS_pept        complement(114886..115143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04380"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37642"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEH5"
FT                   /protein_id="ABK37642.1"
FT                   /translation="MIDPKKLEEIAKQVHNSLPPGIRSMGEEVEKKIRQVLQSQLGKLD
FT                   LVSREEFDVQTKVLLRTREKLTALEAKLAQLEQQLGAKGE"
     atgatcgacc cgaagaaact ggaagagatc gccaaacagg tgcacaactc cctgccgccc        60
     ggcattcgca gcatgggtga agaggtggag aagaagatcc gtcaggtgct gcagtcccag       120
     ctgggcaagc tggatctggt cagtcgcgaa gagtttgacg tgcagaccaa ggtgctgctg       180
     cgcacccgcg agaagctgac cgcgctcgag gccaagctgg cccagctcga gcagcagctc       240
     ggcgccaagg gcgaataa                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page