(data stored in ACNUC7421 zone)

EMBL: CP000462.PE96

CP000462.PE96        Location/Qualifiers
FT   CDS_pept        complement(118002..118835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0105"
FT                   /product="GlpG protein"
FT                   /note="identified by match to protein family HMM PF01694"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36722"
FT                   /db_xref="GOA:A0KEH7"
FT                   /db_xref="InterPro:IPR022732"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR023662"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="InterPro:IPR038236"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEH7"
FT                   /protein_id="ABK36722.1"
FT                   /translation="MIQLLVLDNARMAQALVDYLSTLGISCELTQSELGVSVWLADEQR
FT                   LAQAQLEVKRFLAEPTHPRYMEASWQSGRADARIDYSKGMTDPVTDFLHQAGPLTLVVI
FT                   IACLAIYGLDAIGLPIFDELAFHPTLAQFTDWQAWRYFTPAFIHFSVLHLVFNLLWWWY
FT                   LGGQIEQRLGSGKLLILLLVGAALPNLAEFFASGPLFGGLSGVVYALLGYCWLRSKLQP
FT                   ACGLTLPPALMGFMLFWLALGFFDLLGTRTANMAHLAGLLVGLLQGWLDRHHQPA"
     atgatccagc tgctggtgct cgacaatgcc cgcatggccc aggcgctggt ggactatctc        60
     tccaccctcg gcatctcgtg cgagctgacc cagtccgagc ttggcgtctc ggtctggctg       120
     gcggacgaac agcgcctcgc ccaggcccag ctggaggtga aacgcttcct ggccgagccg       180
     acccaccccc gctacatgga agcctcctgg caatccggcc gggccgatgc ccgcatcgac       240
     tacagcaagg ggatgaccga cccggtcacc gacttcctgc atcaggccgg gccgttgacc       300
     ctggtggtga tcatcgcctg tctggccatc tacgggctcg atgccatcgg cctgccgatc       360
     ttcgatgagc tggcgttcca cccgaccctg gcccagttca ccgactggca ggcgtggcgc       420
     tacttcaccc cggccttcat ccacttctcg gtgctgcacc tggtgttcaa cctgctgtgg       480
     tggtggtatc tggggggcca gatcgaacaa cggctcggca gcggcaagct gctgatcctg       540
     ctgctggtag gcgccgccct gcccaacctg gccgagttct tcgccagcgg cccgctgttt       600
     ggcggcctct ccggggtggt ctatgccctg ctcggctact gctggctgcg cagcaagttg       660
     cagccggcct gtggcctcac cctgccaccg gcgctgatgg gcttcatgct gttctggctg       720
     gcactcggct tcttcgatct gctcggcacc cgcaccgcca acatggccca cctggccggt       780
     ctgctggtcg ggctgctgca gggctggctg gacagacacc accagcccgc ctga             834
//

If you have problems or comments...

PBIL Back to PBIL home page