(data stored in ACNUC7421 zone)

EMBL: CP000462.PE97

CP000462.PE97        Location/Qualifiers
FT   CDS_pept        complement(118832..119155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0106"
FT                   /product="thiosulfate sulfurtransferase GlpE"
FT                   /EC_number="2.8.1.1"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36237"
FT                   /db_xref="GOA:A0KEH8"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEH8"
FT                   /protein_id="ABK36237.1"
FT                   /translation="MDQFAHISAHDAHQKLAAGAARLVDIRDPQSFETAHAVGAFHLTN
FT                   GTLVRFMNEVDFDTPVIVMCYHGNSSQGAAQYLLQQGYDEVYSLDGGFEAWRREFPIQA
FT                   GDA"
     atggaccagt ttgcccatat cagtgcccat gatgcccacc agaagcttgc cgccggtgca        60
     gcccgcctcg tggatattcg cgacccccag tcattcgaga cggcccacgc ggtcggcgcc       120
     ttccacctca ccaatggcac cctggtgcgt ttcatgaacg aggtggactt cgataccccg       180
     gtgatcgtga tgtgctatca cggcaacagc agccagggcg ccgcccagta cctgctgcaa       240
     caggggtacg atgaggtcta tagcctggat ggcggcttcg aggcgtggcg cagggagttc       300
     ccgatccagg cgggcgacgc atga                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page