(data stored in ACNUC7421 zone)

EMBL: CP000462.PE98

CP000462.PE98        Location/Qualifiers
FT   CDS_pept        119226..119912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0108"
FT                   /product="efflux protein, LysE family"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37718"
FT                   /db_xref="GOA:A0KEH9"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEH9"
FT                   /protein_id="ABK37718.1"
FT                   /translation="MSGYCRDRSQFPSIPGAGCRLGWGLLLLLRALFMETSLLLSMAGF
FT                   ALAMSITPGPVNLVALGSGARHGFAASLRHVVGATLGFILLLLLMGLGLGATLLQWPLA
FT                   AELLRWAGVIFLGWMAWQLLVDSGRVEGVDGVAPSFWYGALMQWLNPKAWLAASMGMGA
FT                   YGSAGGVGQVALFSGLYLVICLGSIACWAYAGSRLQGVLLAPQRLRWFNRAMALLLLLC
FT                   AAYLVR"
     gtgtccggtt attgtcgtga ccgatcgcaa tttccttcaa taccgggggc ggggtgccgg        60
     ctaggctggg ggctcctttt gctgctacga gcgttattca tggagacgag tctgctgtta       120
     tccatggccg ggtttgccct ggccatgtcc atcaccccgg ggccggtcaa tctggttgcc       180
     ctcggcagcg gcgccaggca cggctttgcg gccagcctgc ggcacgtggt cggggccacc       240
     ctggggttca ttctgttgct gctgttgatg ggactggggt tgggcgccac cctgctgcag       300
     tggccgctgg cggcggagct gctgcgctgg gccggggtga tctttctcgg ctggatggcc       360
     tggcagctgc tggtggacag cggccgggta gaaggggttg acggggtggc gccctccttc       420
     tggtacgggg cactgatgca gtggctcaat cccaaggcct ggctcgccgc cagcatgggg       480
     atgggcgcct atggcagtgc gggcggggtg gggcaggtgg ccctgttcag cggcctctac       540
     ctggtcatct gtctcggctc tatcgcttgc tgggcctatg ccggcagccg attgcagggg       600
     gtgctgctcg cgccgcagcg gctgcgctgg ttcaaccggg cgatggcgct gttgctgctg       660
     ctttgcgccg cctatctggt gcgttag                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page