(data stored in ACNUC7421 zone)

EMBL: CP000462.PEPQ

CP000462.PEPQ        Location/Qualifiers
FT   CDS_pept        158961..160283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="AHA_0141"
FT                   /product="Xaa-Pro dipeptidase"
FT                   /EC_number="3.4.13.9"
FT                   /note="identified by similarity to SP:P21165; match to
FT                   protein family HMM PF00557"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36051"
FT                   /db_xref="GOA:A0KEL3"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEL3"
FT                   /protein_id="ABK36051.1"
FT                   /translation="MSSYSQLFAQHLDTLQQRTRDILQQQGLSGLAIHSGQTHRIFLDD
FT                   QDYPFKVNPQFKAWLPVLDNPHCWLLVDGVNKPVLLFYRPVDFWHKVAELPNAFWVDFF
FT                   DIRFLTRPEQVADHLPANKQEWAYLGGHLEVAELLGLGQPNPEAVLNYLHYHRAYKTAY
FT                   ELECLRDANRIGVRGHIAAKDSFMAGASEFEINLAYMKAVGQGANEAPYGNIVAINRNA
FT                   AILHYTHLSAQRVPDAERYSFLIDAGVDVHGYASDITRTWAWRRGEFADLIAALDAQQQ
FT                   EIIEEIKPGRRYSELHLQMHHRLARLLQATELVDMSVDEMIHTGVTNVFFPHGLGHFLG
FT                   LQVHDAGGFMQDERGTHLSAPEQFPYLRCTRVMEVGQVFTIEPGLYFIDSLLEPLRLGE
FT                   QGKRVNWNKVEALRPYGGIRIEDNVVLHANGVENLTRQAGL"
     atgagcagct acagccaact ttttgcccag cacctcgaca ccttgcagca gcgtacccgc        60
     gacatactgc aacagcaggg actgagcggt ctggccatcc actccggcca gacccaccgc       120
     atcttcctcg atgatcagga ttaccccttc aaggtgaacc cccagttcaa ggcctggttg       180
     ccggtgctgg ataatcccca ctgctggttg ctggtggacg gcgtgaacaa gccggtgttg       240
     ctgttctacc ggccggtgga tttttggcac aaggtggcgg aactgcccaa cgccttctgg       300
     gtcgacttct tcgatatacg cttcctgacc cgcccggagc aggttgccga tcacctgccg       360
     gccaacaagc aggagtgggc ctatctgggc ggccacctgg aggtggccga gctgctgggg       420
     ctgggccagc ccaatccgga ggcggtgctc aactatctgc attatcatcg tgcctacaag       480
     acggcctacg agctggaatg cctgcgcgat gccaaccgca ttggggtacg cggccacatt       540
     gcggccaagg actccttcat ggcgggggcg agcgagttcg agatcaacct ggcctacatg       600
     aaggcggtcg ggcagggggc caatgaggcg ccctacggca atatcgttgc catcaaccgc       660
     aatgcggcca tcctgcacta cacccacctc tccgctcagc gggtgcccga tgcggagcgg       720
     tactccttcc tcatcgatgc cggtgtggat gtgcacggct atgcctccga catcacccgg       780
     acctgggcct ggcgccgcgg tgagtttgcc gatctgattg cggcgctgga tgcccagcag       840
     caggagatca tcgaggagat caagccgggc cgccgttaca gcgagctgca tctgcagatg       900
     caccaccgac tggcgcgcct gctgcaagcc accgagctgg tggacatgtc ggtggacgag       960
     atgatccata ccggggtgac caacgtcttc ttcccccacg gtctcggcca cttcctcggc      1020
     ctgcaggtac acgatgccgg cggtttcatg caggatgagc gcggtactca cctgtcggcc      1080
     cccgaacagt ttccctattt gcgctgcacc cgggtgatgg aggtgggcca ggtgttcacc      1140
     atcgagccgg gtctctactt cattgacagc ctgctggagc cgctgcgcct cggtgaacag      1200
     ggcaagcggg tcaactggaa caaggtcgag gcgctgcgcc cctatggcgg catccgcatc      1260
     gaagacaacg tggtgctgca tgccaacggg gtggaaaacc tgaccagaca agcagggctc      1320
     tga                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page