(data stored in ACNUC7421 zone)

EMBL: CP000462.PURE-1

CP000462.PURE-1      Location/Qualifiers
FT   CDS_pept        complement(78228..78737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE-1"
FT                   /locus_tag="AHA_0070"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF00731;
FT                   match to protein family HMM TIGR01162"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37859"
FT                   /db_xref="GOA:A0KEE2"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEE2"
FT                   /protein_id="ABK37859.1"
FT                   /translation="MNTPPLIGLVMGSDSDWPVMQAAARILKEHGVPYEARVVSAHRTP
FT                   DLLFEYAASARERGLRAIIAGAGGAAHLPGMVAAKTTIPVLGVPIPTRQLKGMDSLLSI
FT                   VQMPKGVPVATFAIGEAGAANAGLFAVSLLSVAQDGDAPRYQQQLDGFRANERDRVLAL
FT                   TLEDPA"
     atgaataccc ctcccctgat cggcctggta atgggatccg actccgactg gcccgtgatg        60
     caggccgccg cccgcatcct caaggagcat ggcgtcccct atgaggcgcg cgtggtctcg       120
     gcccaccgca ccccggatct gctgttcgaa tatgccgcca gcgcccgtga gcgtggcctg       180
     cgcgccatca tcgccggggc tggcggcgcc gcccatctgc cgggcatggt ggccgccaag       240
     accaccattc cggtgctggg tgtgcccatc ccgacccgcc agctcaaggg gatggactcc       300
     ctgctctcca tcgtgcagat gcccaagggg gtaccggtcg ccaccttcgc catcggcgag       360
     gcgggcgccg ccaacgccgg cctgtttgcg gtctccctgc tctccgtcgc gcaagacggc       420
     gatgcccccc gctaccagca acagctcgac ggctttcgcg ccaacgaacg cgaccgggtg       480
     ctggccctca cgctggagga cccggcatga                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page