(data stored in ACNUC7421 zone)

EMBL: CP000462.PURE-2

CP000462.PURE-2      Location/Qualifiers
FT   CDS_pept        287199..287702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE-2"
FT                   /locus_tag="AHA_0263"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF00731;
FT                   match to protein family HMM TIGR01162"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39569"
FT                   /db_xref="GOA:A0KEX5"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEX5"
FT                   /protein_id="ABK39569.1"
FT                   /translation="MNKPFVAVLMGSDSDFPVMQTTLEVLKSFDIAVEVKVTSAHRTPA
FT                   ATHQYVTDAEARGCKVFICAAGLAAHLAGAVAGITTRPVIGVPIDGGPLKGLDALLSTV
FT                   QMPGGVPVATVAIGKAGAKNAGYLAAQMLAVADDELAAKVQAERQKNADEVLAKDAALQ
FT                   ALLK"
     atgaataaac cctttgttgc cgtattgatg ggctctgatt ctgattttcc ggtgatgcag        60
     accaccctcg aggtgctcaa gtcattcgat atcgcggtag aagtgaaagt gacctccgca       120
     caccgtacac cggctgctac tcatcagtac gtgaccgacg ccgaagcccg tggctgcaag       180
     gtctttatct gtgccgccgg tctcgctgct cacctggcgg gcgccgtggc aggcatcacg       240
     actcgtcccg tgatcggtgt gcccatcgat ggcggcccgc tcaaggggct ggatgcactg       300
     ctttccaccg tgcagatgcc gggtggggtg ccggtggcga ccgtggcgat cggcaaggcc       360
     ggcgccaaga atgcaggcta tctggcagct cagatgctgg cagtggcgga tgatgaactg       420
     gcggccaagg tgcaggcaga acgccagaaa aatgccgacg aggtactggc gaaagacgct       480
     gccttacagg ccctgctcaa gtaa                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page