(data stored in ACNUC7421 zone)

EMBL: CP000462.PURK

CP000462.PURK        Location/Qualifiers
FT   CDS_pept        complement(77107..78231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="AHA_0069"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF01071;
FT                   match to protein family HMM PF02222; match to protein
FT                   family HMM TIGR01161"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37904"
FT                   /db_xref="GOA:A0KEE1"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEE1"
FT                   /protein_id="ABK37904.1"
FT                   /translation="MILPPATLGMLGGGQLGRYFVMAAHRLGYKVVVLDPDPASIAGAA
FT                   ADHHIVAAYDDPTALHDLASRCAAVTCEFENVPATALALLEQYQPVRPAAGAVRICQDR
FT                   REEKAFLSRAGIPVAPNQTLLPGEPLPALPASLFPAILKTAREGYDGKGQWTIQAADQL
FT                   PAALAASGVPCVLEQRLALEGEFSLTLARSPSGAIGALPLVQNWHSGGILDQTRSPANV
FT                   PALEADARRIAEQLIAALDYVGVLTVELFLVAGKLLVNELAPRPHNSGHPSLDNAECSQ
FT                   FELQVRALCDLPLPSRIAVRPAMLLNLLGDLWQAGTPDWAALLALPGVHLHLYGKGEPR
FT                   PGRKMGHVTITAADWPTVEETCQRVRQLLGLPPR"
     atgatactgc cacccgccac cctcggcatg ctgggaggcg gccaacttgg ccgctacttc        60
     gtgatggccg cccaccggct cggctacaag gtggtggtgc tggacccgga tcccgccagc       120
     atcgccggtg cggcagccga tcaccatatt gttgccgcct atgacgaccc gaccgccctg       180
     cacgatctgg ccagccgctg cgccgccgtc acctgcgagt tcgagaacgt gccggccacc       240
     gccctggccc tgctggagca gtaccagccg gtacgcccgg ccgccggcgc cgtgcgcatc       300
     tgtcaggatc gccgcgaaga gaaggccttc ttgagcagag ccggcatccc ggtcgctccc       360
     aaccagaccc tgctgccggg cgagccgctg ccggcgctgc ccgcctctct cttccccgcc       420
     atcctcaaga cggcccgcga ggggtacgac ggcaaaggcc agtggaccat tcaggccgcc       480
     gatcagctgc cggcagcgct ggccgccagc ggcgtaccct gcgtgctgga acagcggctg       540
     gcgctggagg gtgagttttc cctgaccctg gcccgcagcc cgagcggtgc catcggtgcc       600
     ctgccgctgg tgcagaactg gcacagcggc ggcattctgg accagacccg ctccccggcc       660
     aacgtaccgg cgctggaggc cgacgccaga cgcattgccg aacagctgat cgccgccctc       720
     gactacgtcg gcgtgctgac ggtggagctc ttcctggtgg caggcaaact gctggtcaac       780
     gagctggcgc cacgtcccca caactcgggc caccccagcc tcgacaacgc cgagtgcagc       840
     cagttcgagc tgcaggtgcg cgccctgtgc gatctgccgc tgccatcccg aatcgccgta       900
     cgccccgcca tgttgctcaa cctgctgggg gatctctggc aggccggcac gccagactgg       960
     gccgccctgc tggcactgcc cggcgtgcat ttgcacctct acggcaaggg ggaaccccgc      1020
     cccggccgca agatgggcca tgtcaccatc accgccgccg actggccgac ggtggaagag      1080
     acctgccagc gggtgcgcca gctgttgggg ctgccgccac gctga                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page