(data stored in ACNUC7421 zone)

EMBL: CP000462.PYK-1

CP000462.PYK-1       Location/Qualifiers
FT   CDS_pept        complement(30404..31483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyk-1"
FT                   /locus_tag="AHA_0029"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="identified by match to protein family HMM PF00224;
FT                   match to protein family HMM TIGR01064"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36375"
FT                   /db_xref="GOA:A0KR09"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR09"
FT                   /protein_id="ABK36375.1"
FT                   /translation="MRKTKIIATLGPASSSAAMVEQLIQAGANVFRLNFSHGSPEQHLA
FT                   LAARIRACAARLDREIGILADLQGPKIRIASFADGCIRLQPGDPFTIDAGLDSHQGDQS
FT                   RVGTDYPALAGELQTGNVVLLDDGRIQLCVEQVIDERIETRVLVGGTLSSRKGINVLGG
FT                   GLSAPALTDKDKADILTARLLEADYIAVSFPRSAADLEEARTLIRASGSRAAIVAKVER
FT                   AEVVASVAAMDELIHAADLIMVARGDLGVEIGDARLPGVQKRLIRRCRALGRPVITATQ
FT                   MMESMIASPMPTRAEVMDVANAVMDGSDAVMLSAESATGRYPVEAVAAMARIALAAEQE
FT                   MEPAGHGLAASHGELARLA"
     atgcgcaaga ccaaaatcat cgccaccctg ggcccggcca gctcatccgc cgccatggtg        60
     gagcagttga tccaggcggg agccaatgta ttcaggctga acttctccca cggcagtccg       120
     gagcaacacc tggccctggc ggccagaatt cgggcctgcg ccgcccgcct cgaccgcgag       180
     ataggcatcc tcgccgacct gcagggcccc aagatccgca tcgctagctt tgccgacggc       240
     tgcatccggc tgcaaccggg cgaccccttc accatcgatg ccggcctgga cagccaccag       300
     ggcgatcaat cccgggtcgg taccgactat ccggcgctgg ccggcgaact gcagacgggc       360
     aacgtcgtgc tgctggatga cggccgcatc cagctctgtg tggaacaggt gatcgacgag       420
     cgcatcgaaa cccgggtgct ggtcggcggc accctgtcca gccgcaaggg catcaacgtg       480
     ctgggcggcg gtctgagcgc tccggccctg accgacaagg acaaggccga catcctgacg       540
     gcccgcctgc tcgaggccga ctatatcgcc gtctcgtttc cgcgcagcgc cgccgatctc       600
     gaagaggcca gaaccctcat tcgtgccagc ggtagccggg cggccatagt ggccaaggtg       660
     gaacgggcgg aggtggtggc gtcagtggcc gccatggatg agctgattca cgccgccgac       720
     ctcatcatgg tggcgcgtgg ggatctgggg gtcgagattg gcgatgccag actgcccggc       780
     gtgcagaaga ggttgatccg gcgctgccgg gcgctcggcc gcccggtcat caccgctacc       840
     cagatgatgg agtccatgat tgccagcccc atgcccaccc gggccgaggt catggatgtg       900
     gccaacgccg tcatggatgg cagcgatgcg gtgatgctgt cggccgagtc ggcaaccggc       960
     cgctatccgg tggaagcggt cgccgccatg gcccgcatcg cgctggccgc cgaacaggag      1020
     atggaaccgg cagggcatgg cctcgcggcc agccacgggg agctagccag gttggcctga      1080
//

If you have problems or comments...

PBIL Back to PBIL home page