(data stored in ACNUC7421 zone)

EMBL: CP000462.RPLB

CP000462.RPLB        Location/Qualifiers
FT   CDS_pept        337371..338192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="AHA_0312"
FT                   /product="ribosomal protein L2"
FT                   /note="identified by match to protein family HMM PF00181;
FT                   match to protein family HMM PF03947; match to protein
FT                   family HMM TIGR01171"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36495"
FT                   /db_xref="GOA:A0KF24"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF24"
FT                   /protein_id="ABK36495.1"
FT                   /translation="MAIVKCKPTSPGRRHVVKIVNQDLYKGKPFAALLDKKDKSGGRNN
FT                   NGRITTRHIGGGHKQHYRIVDFKRDKDGIPAKVERLEYDPNRTANIALVLYADGERRYI
FT                   LAPKGLKAGDAIASGADAAIKVGNTLPMRNIPVGSTVHAVEMKPGKGAQLARSAGTFIQ
FT                   ILAREGNYVTLRLRSGEVRKVLAECRATIGEVGNSEHMLRQLGKAGANRWRGIRPTVRG
FT                   MAMNPVDHPHGGGEGRNKGMQPVSPWGQKAKGFKTRKNKRTDKYIVRRRNK"
     atggcaatcg ttaagtgcaa gcctacttct ccgggccgcc gccacgtcgt caagatcgtc        60
     aaccaagacc tgtacaaggg caagcccttt gcagctctgc tggacaagaa agacaagtcc       120
     ggtggtcgta acaacaacgg ccgcatcacc acccgtcaca tcggcggtgg tcacaagcaa       180
     cactaccgta tcgtcgactt caagcgcgac aaagacggta tcccggccaa agtagagcgc       240
     ctggaatacg atcctaaccg taccgcaaac atcgccctgg tgctgtatgc agacggtgag       300
     cgtcgttaca tcctggctcc gaaaggcctg aaagctggtg atgcaatcgc ttctggtgct       360
     gatgccgcaa tcaaggtagg taacaccctg ccgatgcgca acatcccggt cggttctacc       420
     gttcacgctg ttgagatgaa gcctggtaaa ggtgcccagc tggctcgttc cgctggtact       480
     ttcatccaga tcctggctcg tgaaggtaac tatgtaactc tgcgtctgcg ttccggcgaa       540
     gtacgtaaag ttctggccga gtgccgcgcc accatcggtg aagttggtaa ctccgagcac       600
     atgctgcgtc aactgggtaa agccggtgca aaccgctggc gtggtattcg tccgaccgtt       660
     cgcggtatgg cgatgaaccc ggtcgaccac ccgcacggtg gtggtgaggg tcgcaacaag       720
     ggcatgcagc ctgtgtcccc atggggccag aaggctaaag gcttcaagac ccgtaagaac       780
     aagcgtaccg acaagtacat cgtacgtcgt cgtaacaagt aa                          822
//

If you have problems or comments...

PBIL Back to PBIL home page