(data stored in ACNUC7421 zone)

EMBL: CP000462.RPLO

CP000462.RPLO        Location/Qualifiers
FT   CDS_pept        344173..344610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="AHA_0328"
FT                   /product="ribosomal protein L15"
FT                   /note="identified by match to protein family HMM PF00256;
FT                   match to protein family HMM PF01305; match to protein
FT                   family HMM TIGR01071"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35971"
FT                   /db_xref="GOA:A0KF40"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF40"
FT                   /protein_id="ABK35971.1"
FT                   /translation="MRLNTLSPAAGSKRVKHRPGRGIGSGLGKTGGRGVKGQTSRSGGG
FT                   KVRNGFEGGQMPLKIRLPKFGFFSRKSLVSAEVRLNEIALVEGDVVDVSTLKQAGVITK
FT                   NIVFAKVVLSGNIDRAVTVRGLSVTKGARAAIEAAGGKIEE"
     atgcgtctga atactctgtc tccggccgct ggctccaagc gcgttaagca ccgtccgggc        60
     cgtggtatcg gttctggtct gggcaagacc ggtggtcgtg gtgttaaagg tcaaacctct       120
     cgttccggtg gcggcaaagt ccgcaacggt ttcgaaggcg gccagatgcc tttgaaaatc       180
     cgtctgccga agttcggttt cttctcccgc aaatctttgg tttctgccga agtgcgcctg       240
     aacgaaatcg ccctggtaga aggtgatgtg gtcgacgtga gcactctgaa gcaagccggt       300
     gttattacta aaaacatcgt gttcgctaaa gttgttctgt ctggcaacat tgaccgtgct       360
     gtgaccgttc gtggtctgtc cgtcaccaaa ggtgcacgtg cagccatcga ggccgctggc       420
     ggtaaaatcg aggaataa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page