(data stored in ACNUC7421 zone)

EMBL: CP000462.RPLP

CP000462.RPLP        Location/Qualifiers
FT   CDS_pept        339579..339992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="AHA_0316"
FT                   /product="ribosomal protein L16"
FT                   /note="identified by match to protein family HMM PF00252;
FT                   match to protein family HMM TIGR01164"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37882"
FT                   /db_xref="GOA:A0KF28"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF28"
FT                   /protein_id="ABK37882.1"
FT                   /translation="MLQPKRTKFRKTHKGRNRGLANSGNEVSFGTFGLKATSRGQLTAR
FT                   QIEAARRAMTRHVKRQGKIWIRVFPDKPITEKPLEVRMGKGKGNVEYWVCPIQPGKVLY
FT                   EMDGVPEALAREAFALAAAKLSVQTTFVIKTVM"
     atgttgcaac caaagcgtac taaattccgc aagacccaca agggtcgtaa ccgcggtctg        60
     gccaactctg gtaacgaagt atccttcggt acctttggcc tgaaggcgac atcccgtggt       120
     caactgactg ctcgtcaaat cgaagcagcc cgtcgtgcca tgacccgtca cgttaagcgt       180
     caaggcaaga tctggatccg tgtgttcccg gacaagccca tcaccgaaaa gcccctcgaa       240
     gttcgtatgg gtaaaggtaa gggtaacgtg gaatactggg tttgcccgat ccagcctggc       300
     aaggttctgt acgagatgga tggtgtacct gaggctctgg cgcgtgaagc gtttgccctg       360
     gccgcagcta agctgtccgt tcagaccact ttcgtaatta agacggtgat gtga             414
//

If you have problems or comments...

PBIL Back to PBIL home page