(data stored in ACNUC7421 zone)

EMBL: CP000462.RPLQ

CP000462.RPLQ        Location/Qualifiers
FT   CDS_pept        348707..349090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="AHA_0334"
FT                   /product="ribosomal protein L17"
FT                   /note="identified by match to protein family HMM PF01196;
FT                   match to protein family HMM TIGR00059"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35840"
FT                   /db_xref="GOA:A0KF46"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF46"
FT                   /protein_id="ABK35840.1"
FT                   /translation="MRHRLSGRQLNRNSSHRQAMFRNMASSLVRHEIIKTTLPKAKELR
FT                   RVVEPLITLAKTDSVANRRLAFARTRDNAIVAKLFNELGPRYLERAGGYTRILKCGFRA
FT                   GDNAPMAYIELVDRPAAAEAAAE"
     atgcgccatc gtttgagtgg tcgtcaactg aaccggaaca gcagccatcg tcaggctatg        60
     ttccgcaaca tggccagctc cctggttcgt catgagatca tcaagacgac tctgcctaag       120
     gcaaaagagc tgcgtcgtgt agttgaaccg ctgatcaccc ttgccaagac tgatagcgtt       180
     gctaatcgtc gcctggcatt tgcccgtact cgcgataacg cgatcgtggc taagctgttc       240
     aatgaactgg gcccgcgcta cctggagcgc gccggcggtt atactcgcat tctgaaatgc       300
     ggtttccgtg caggcgacaa cgcccctatg gcttacattg agctggtaga ccgcccggcc       360
     gctgctgaag cagctgctga gtga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page