(data stored in ACNUC7421 zone)

EMBL: CP000462.RPLX

CP000462.RPLX        Location/Qualifiers
FT   CDS_pept        340959..341276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="AHA_0320"
FT                   /product="ribosomal protein L24"
FT                   /note="identified by match to protein family HMM PF00467;
FT                   match to protein family HMM TIGR01079"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37026"
FT                   /db_xref="GOA:A0KF32"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF32"
FT                   /protein_id="ABK37026.1"
FT                   /translation="MAAKIRREDEVIVLTGKDKGKRGKVTQVLIAKGKVIVEGINQVKK
FT                   HQKPVPALGQAGGIVTKEAPIDVSNVALFNSATGKADRVGFRIEDGKKVRFFKSTGELV
FT                   K"
     atggcagcta aaatccgtcg cgaagacgaa gtgattgttc ttaccggcaa agacaagggc        60
     aagcgtggca aagtcactca agtcctgatt gcaaaaggta aggtaatcgt ggaaggcatc       120
     aaccaggtga agaagcacca gaagccggta cccgcactgg gtcaggctgg cggtatcgtc       180
     accaaagaag cccccatcga tgtatctaac gtagcgctgt tcaactctgc cactggcaag       240
     gctgaccgcg ttggtttccg gattgaagac ggcaaaaaag tccgtttctt caaatccacc       300
     ggcgaacttg tgaagtaa                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page