(data stored in ACNUC7421 zone)

EMBL: CP000462.RPMB

CP000462.RPMB        Location/Qualifiers
FT   CDS_pept        181984..182220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="AHA_0161"
FT                   /product="ribosomal protein L28"
FT                   /note="identified by match to protein family HMM PF00830;
FT                   match to protein family HMM TIGR00009"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39915"
FT                   /db_xref="GOA:A0KEM9"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEM9"
FT                   /protein_id="ABK39915.1"
FT                   /translation="MSRVCQVTGKRPAVGNNRSHANNATKRRFLPNLHTHRFWVESEKR
FT                   FVSLRVSAKGMRIIDKRGVEVVLAELRASGVKV"
     atgtctagag tatgccaagt aaccggcaag cgcccggcag ttggtaacaa ccgttcgcac        60
     gctaacaacg ctaccaagcg tcgtttcctg ccgaacctgc acactcaccg tttttgggtt       120
     gagagtgaaa aacgcttcgt aagcctgcgc gtatccgcaa aaggcatgcg tatcatcgac       180
     aagcgtggcg ttgaagtggt tctggctgaa ctgcgcgcca gcggtgttaa ggtataa          237
//

If you have problems or comments...

PBIL Back to PBIL home page