(data stored in ACNUC7421 zone)

EMBL: CP000462.RPMC

CP000462.RPMC        Location/Qualifiers
FT   CDS_pept        339989..340183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="AHA_0317"
FT                   /product="ribosomal protein L29"
FT                   /note="identified by match to protein family HMM PF00831;
FT                   match to protein family HMM TIGR00012"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39526"
FT                   /db_xref="GOA:A0KF29"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF29"
FT                   /protein_id="ABK39526.1"
FT                   /translation="MMKAQDLRQKSVEELNQELLGLLREQFNMRMQASTGQLAQTHTLK
FT                   QVRRDVARIKTVLTEKAGA"
     gtgatgaaag cccaagatct gcgtcaaaag agcgtcgaag aactgaacca ggagctgctg        60
     ggtctgctgc gtgagcaatt caacatgcgc atgcaagctt ccaccggcca gctggctcag       120
     actcacactc tgaaacaagt gcgtcgtgac gtcgcacgta tcaagactgt actgactgag       180
     aaggcaggtg cgtaa                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page