(data stored in ACNUC7421 zone)

EMBL: CP000462.RPMD

CP000462.RPMD        Location/Qualifiers
FT   CDS_pept        343991..344170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="AHA_0327"
FT                   /product="ribosomal protein L30"
FT                   /note="identified by match to protein family HMM PF00327;
FT                   match to protein family HMM TIGR01308"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39681"
FT                   /db_xref="GOA:A0KF39"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF39"
FT                   /protein_id="ABK39681.1"
FT                   /translation="MANTVKVTQTRSSIGRLPKHKATLRGLGLRRIGHTVELEDTPCVR
FT                   GMINQVYYMVKVEG"
     atggctaaca ctgtaaaagt aactcaaact cgcagctcta tcggccgtct gccaaagcac        60
     aaggcgactc tgcgtggtct gggtctgcgt cgcattggtc acaccgttga gctggaagat       120
     actccctgcg tacgcggcat gatcaaccag gtttattaca tggttaaggt ggagggctaa       180
//

If you have problems or comments...

PBIL Back to PBIL home page