(data stored in ACNUC7421 zone)

EMBL: CP000462.RPOH

CP000462.RPOH        Location/Qualifiers
FT   CDS_pept        390490..391344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="AHA_0374"
FT                   /product="alternative sigma factor RpoH"
FT                   /note="identified by similarity to SP:P11539; match to
FT                   protein family HMM PF04542; match to protein family HMM
FT                   PF04545; match to protein family HMM TIGR02392; match to
FT                   protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37097"
FT                   /db_xref="GOA:A0KF81"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF81"
FT                   /protein_id="ABK37097.1"
FT                   /translation="MGTSLQRTMALIPQGSLEGYIQAVNSIPVLSAEEERELAERLQQG
FT                   GDLEAARQLVMSHLRFVVHVAKSYAGYGLPQADLVQEGNIGLMKAVKRFDPSVGVRLVS
FT                   FAVHWIKAEIHEYVLRNWRMVKVATTKAQRKLFFNLRKSKKRLGWLNHEEVQAVAADLG
FT                   VSAADVTEMEARMSNYDQAFDLVGDDEEEGGFAPVHYLEDKSSDLAATIENDNWDDHAT
FT                   RRLSSALATLDERSQHIIRARWLDDESKTTLQELADTYGVSAERVRQLEKNALKKLKDA
FT                   MEA"
     atgggaactt cattgcagcg cactatggct ctgattccgc aaggtagtct ggaaggctat        60
     attcaggcag ttaactcgat tccggtgctg agcgcagagg aagagcgtga gctggctgag       120
     cgtttgcagc agggtggcga tcttgaggct gcccgtcagc tcgttatgtc gcacctgcgc       180
     tttgtcgttc atgtcgccaa gagttatgcc ggctacggtc tgccccaggc cgacctggtg       240
     caggaaggca acatcggcct gatgaaggcg gtcaagcgct tcgacccgag tgtcggtgtg       300
     cgtctggtct cctttgccgt gcactggatc aaggccgaaa ttcacgaata cgttctgcgc       360
     aactggcgca tggtcaaggt ggcgaccacc aaggcccagc gcaagctgtt cttcaatctg       420
     cgcaaatcca agaaacgtct gggctggctg aaccacgaag aggtgcaggc cgtggctgcc       480
     gacctcggcg tctccgccgc cgacgtcacc gagatggaag cgcgcatgag caattacgat       540
     caggcgttcg atctggtcgg cgatgacgaa gaagagggcg gtttcgcgcc ggtccactat       600
     ctggaggaca aatcctccga tctggcggcc accatcgaga acgacaactg ggacgatcac       660
     gcgacacgtc gcttgagctc ggccctggct accttggacg agcgcagcca gcacatcatc       720
     cgtgcccgct ggctcgacga tgagagcaag accaccctgc aggagctggc cgatacctac       780
     ggcgtctccg ccgagcgggt ccgtcaactt gagaaaaacg cgctcaagaa gctgaaagat       840
     gccatggaag cctga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page