(data stored in ACNUC7421 zone)

EMBL: CP000462.RPSE

CP000462.RPSE        Location/Qualifiers
FT   CDS_pept        343484..343984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="AHA_0326"
FT                   /product="ribosomal protein S5"
FT                   /note="identified by match to protein family HMM PF00333;
FT                   match to protein family HMM PF03719; match to protein
FT                   family HMM TIGR01021"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39378"
FT                   /db_xref="GOA:A0KF38"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF38"
FT                   /protein_id="ABK39378.1"
FT                   /translation="MAKVESQAGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGR
FT                   VGYGYGKAREVPAAIQKAMEQAKRNLNKVELNNGTLHHPVRGVHSGSTVFMKPASQGTG
FT                   IIAGGAMRAVLEVAGIHNVLAKTYGSTNPINVVRATVDALVQGQSPAQIAAKRGLRVEE
FT                   ILG"
     atggctaaag tcgaatctca agccggcgaa ctgcaagaaa agctgattgc agtaaaccgt        60
     gtttcgaaaa ctgttaaagg tggtcgtatc atgtccttca ccgcgttgac cgtggtgggt       120
     gatggtaacg gccgtgtagg ttacggttac ggtaaagccc gtgaagttcc ggccgcaatt       180
     caaaaagcga tggaacaggc taagcgtaac ctgaacaagg ttgagctgaa caacggcact       240
     ctgcaccacc cggtgcgtgg tgttcactcc ggttccaccg tgttcatgaa gccggcctct       300
     caaggtactg gtatcattgc aggcggcgcc atgcgtgctg ttctggaagt tgctggtatc       360
     cacaacgtgc tggccaagac ctacggttcc accaacccaa tcaacgttgt tcgcgcaact       420
     gtcgacgctc tggtacaggg tcaatccccg gcccagatcg ctgccaagcg tggtctgcgc       480
     gttgaagaaa ttctggggta a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page