(data stored in ACNUC7421 zone)

EMBL: CP000462.RPSH

CP000462.RPSH        Location/Qualifiers
FT   CDS_pept        342167..342559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="AHA_0323"
FT                   /product="ribosomal protein S8"
FT                   /note="identified by match to protein family HMM PF00410"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36961"
FT                   /db_xref="GOA:A0KF35"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF35"
FT                   /protein_id="ABK36961.1"
FT                   /translation="MSMQDPIADMLTRIRNGQAASKVAVSMPSSKLKVAIAKVLKEEGY
FT                   ITGYSVAGDVKPELEIELKYFQGKPVVELIQRVSRPGLRIYKRTTDLPKVMGGLGVAIV
FT                   STSKGVMTDRAARKASMGGEIICYVA"
     atgagcatgc aagatccgat cgcggatatg ctgacccgca tccgtaacgg tcaggcggcg        60
     agcaaagttg cggtttccat gccttcttcc aagctgaaag tggctatcgc caaagtgctg       120
     aaagaagaag gttacatcac tggctactcc gtagctggtg acgtgaagcc ggaactggaa       180
     attgaactga aatatttcca gggcaagcca gttgtagaac tgatccaacg cgtgagccgt       240
     cccggcctgc gtatttacaa gcgcactact gatctgccga aagttatggg cggtctcggt       300
     gttgctatcg tgtccacgtc taaaggtgtg atgactgacc gtgctgcccg caaagcaagc       360
     atgggcggtg agatcatctg ctacgtcgct taa                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page