(data stored in ACNUC7421 zone)

EMBL: CP000462.RPSK

CP000462.RPSK        Location/Qualifiers
FT   CDS_pept        346599..346988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="AHA_0331"
FT                   /product="ribosomal protein S11"
FT                   /note="identified by match to protein family HMM PF00411"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38687"
FT                   /db_xref="GOA:A0KF43"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF43"
FT                   /protein_id="ABK38687.1"
FT                   /translation="MAKTPTRARKRVKKQVSDGIAHVHASFNNTIVTITDRQGNALSWA
FT                   TSGGSGFRGSRKSTPFAAQVAAERAGEIAKEYGVKNLEVMVKGPGPGRESSIRALNAAG
FT                   FRITNITDVTPIPHNGCRPPKKRRV"
     atggctaaaa ctccgactcg tgctcgcaag cgcgttaaaa agcaagtgag cgacggtatt        60
     gcgcacgttc atgcatcttt caacaacaca atcgtgacca ttactgaccg tcagggtaat       120
     gctctgtcat gggctacctc tggtggttca ggtttccgtg gttcccgtaa gtccactccg       180
     tttgctgccc aggtagctgc tgagcgtgct ggtgagatcg ccaaagaata cggcgtgaag       240
     aacctggaag tcatggtcaa aggtccgggt cccggtcgtg agtcttccat ccgcgctctg       300
     aacgcggctg gtttccgcat cactaacatt actgatgtga ctccgatccc gcacaacggt       360
     tgtcgtcctc ccaagaagcg ccgcgtgtaa                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page