(data stored in ACNUC7421 zone)

EMBL: CP000462.RPSQ

CP000462.RPSQ        Location/Qualifiers
FT   CDS_pept        340183..340431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="AHA_0318"
FT                   /product="ribosomal protein S17"
FT                   /note="identified by match to protein family HMM PF00366"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36645"
FT                   /db_xref="GOA:A0KF30"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF30"
FT                   /protein_id="ABK36645.1"
FT                   /translation="MTDKIRTLQGRVISDKMDKSITVAIERKVKHPIYGKIIKRTTKLH
FT                   VHDENNECKAGDLVEIRECRPLSKTKSWTLVAVVEKA"
     atgactgaca agatccgtac tctgcaaggt cgtgtaatca gcgacaagat ggacaagtcc        60
     atcactgttg ctatcgagcg caaggtaaag cacccgatct acggtaagat catcaagcgc       120
     actaccaagc tgcacgtaca tgatgaaaac aacgaatgca aagctggcga cctcgtggaa       180
     atccgcgaat gccgcccgct gtccaagacc aagtcctgga ccctggttgc cgttgtagaa       240
     aaggcctaa                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page