(data stored in ACNUC7421 zone)

EMBL: CP000462.RPSS

CP000462.RPSS        Location/Qualifiers
FT   CDS_pept        338215..338493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="AHA_0313"
FT                   /product="ribosomal protein S19"
FT                   /note="identified by match to protein family HMM PF00203;
FT                   match to protein family HMM TIGR01050"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39570"
FT                   /db_xref="GOA:A0KF25"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF25"
FT                   /protein_id="ABK39570.1"
FT                   /translation="MPRSLKKGPFIDLHLLKKVEKAVESGDKKPVKTWSRRSMIIPNMI
FT                   GLTIAVHNGRQHVPVFVTEEMIGHKLGEFAPTRTYRGHAADKKAKKR"
     atgccacgtt ctctcaagaa gggtccattt attgacctgc acttgctgaa gaaggtagag        60
     aaagcggtgg aaagcgggga taaaaagccg gttaagacct ggtcccgtcg ttcaatgatc       120
     atcccgaaca tgatcggttt gaccatcgct gtccataatg gtcgtcagca cgttccggtt       180
     ttcgttaccg aagaaatgat cggtcacaaa ctgggtgaat tcgcaccgac tcgtacttat       240
     cgcggccatg ctgctgataa gaaggctaag aagcgctaa                              279
//

If you have problems or comments...

PBIL Back to PBIL home page