(data stored in ACNUC7421 zone)

EMBL: CP000462.SUN

CP000462.SUN         Location/Qualifiers
FT   CDS_pept        complement(280913..282205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun"
FT                   /locus_tag="AHA_0256"
FT                   /product="ribosomal RNA small subunit methyltransferase B"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01029;
FT                   match to protein family HMM PF01189; match to protein
FT                   family HMM TIGR00563"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37178"
FT                   /db_xref="GOA:A0KEW8"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEW8"
FT                   /protein_id="ABK37178.1"
FT                   /translation="MKTRAQAALVIQQVLDQGQSLSAVLPAAQEKVAPRDRALLQELCY
FT                   GTLRWLPRLDAAVGEMMDKPLKNKSRIFHYLILVGLYQLIYTRIPAHAAVAETVNAVKL
FT                   LKGTSLRGLINGVLRNFQRSAEVILLRIDRVPSIRLGHPEWLTKRLRQAYPDEWEFIME
FT                   ANNQRPPMWIRNNSQRQSREQMLVRMAEAGINAMAGEEGEDCILLERPCDVTKLPGFEA
FT                   GDCSVQDGAAQQAAALLDPQPGEWVLDACAAPGGKTAHLLERQPALAGVVAVDADDNRL
FT                   KRVQENLDRIGLTAKVIHGDASTPDLWWPEGQFDRILLDAPCSATGVIRRHPDIKWLRR
FT                   DQDIRELAELQHRILGALWSKLKSGGTLLYATCSVLPEENRDQIRAFLAATPDATLVPL
FT                   HAQDTPECPGRQFLPGEAEMDGFYYAKLIKR"
     atgaaaacac gcgcacaggc tgctctcgtc attcaacagg tgctggatca gggccagtcc        60
     ctctccgccg tcctgcctgc tgcccaggag aaggttgcgc cccgcgatcg cgccctcctg       120
     caagaactct gctacggcac cctgcgctgg ctgccccgtc tcgatgcggc ggtcggcgag       180
     atgatggaca agccgctcaa gaacaagagc cgcatcttcc actacctgat cctggtcggt       240
     ctctatcagc tcatctacac ccgcattccg gctcacgccg cggtggccga gaccgtcaac       300
     gccgtcaagc tgctcaaggg cacctccttg cgcggcctca tcaacggtgt gctgcgcaac       360
     ttccagcgca gcgccgaagt cattctgctg cgcatcgacc gtgtccccag cattcgtctc       420
     ggccacccgg agtggctcac caagcggctg cgccaggcct atccggatga gtgggaattc       480
     atcatggagg ccaacaacca gcgcccgccc atgtggatcc gcaacaacag ccagcgccag       540
     agccgcgagc agatgctggt ccgcatggcc gaggccggca tcaatgcgat ggccggtgaa       600
     gagggcgagg attgcatcct gctggaacgt ccctgcgacg tgaccaagct gcccggcttc       660
     gaggccggcg actgttcggt acaggatggc gcagcacaac aggccgccgc gctgctcgac       720
     ccgcagccgg gcgagtgggt gctggatgcc tgcgccgccc ccggtggcaa gaccgcccat       780
     ctgctggagc gccagcccgc gctggccggc gtggtggcgg tcgatgccga cgacaatcgc       840
     ctcaagcggg tgcaggagaa cctggatcgc atcggcctca ccgccaaggt gatccacggc       900
     gatgccagca ccccggatct gtggtggcca gagggtcagt tcgaccgcat cctgctggat       960
     gccccctgct ccgccaccgg cgtcatccgt cgccaccccg acatcaagtg gctgcgtcgg      1020
     gatcaggaca tccgcgagct ggccgagctg caacaccgca tcctcggcgc cctctggtcg      1080
     aaactgaaaa gcggcggtac tctgctgtat gccacctgct ccgtgctgcc ggaagagaac      1140
     cgcgaccaga tccgcgcctt cctcgcggcc accccggatg ccaccctggt gccgctgcat      1200
     gcgcaggaca ccccggagtg cccgggtcgc cagttcctgc cgggcgaggc cgagatggac      1260
     ggcttctact atgccaagct gatcaagcgg taa                                   1293
//

If you have problems or comments...

PBIL Back to PBIL home page