(data stored in ACNUC7421 zone)

EMBL: CP000462.TATA

CP000462.TATA        Location/Qualifiers
FT   CDS_pept        95806..96054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatA"
FT                   /locus_tag="AHA_0087"
FT                   /product="twin arginine-targeting protein translocase TatA"
FT                   /note="identified by similarity to SP:P69428; match to
FT                   protein family HMM PF02416; match to protein family HMM
FT                   TIGR01411"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39575"
FT                   /db_xref="GOA:A0KEF9"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEF9"
FT                   /protein_id="ABK39575.1"
FT                   /translation="MGGISIWQLLIIAVIVVLLFGTKKLRGIGGDLGAAVKGFKKALSD
FT                   EPETKSEQKDAEFPPKQLNEAAGQPSDAAKQKDKDQA"
     atgggtggta tcagtatttg gcaattgttg atcatcgcag tcatcgtcgt gctgctgttc        60
     ggtaccaaga aactgcgcgg catcggcggt gatctgggtg ccgcggtcaa gggcttcaag       120
     aaggcgctgt ccgacgagcc ggagaccaag tccgagcaga aggatgccga gtttccgccg       180
     aaacagctga acgaagcagc cggtcagcct agcgatgctg ccaagcagaa agataaagat       240
     caggcctaa                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page