(data stored in ACNUC7421 zone)

EMBL: CP000462.THIF

CP000462.THIF        Location/Qualifiers
FT   CDS_pept        472161..472919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiF"
FT                   /locus_tag="AHA_0441"
FT                   /product="thiazole biosynthesis adenylyltransferase ThiF"
FT                   /note="identified by similarity to SP:P30138; match to
FT                   protein family HMM PF00899; match to protein family HMM
FT                   PF05237"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38994"
FT                   /db_xref="GOA:A0KFE8"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFE8"
FT                   /protein_id="ABK38994.1"
FT                   /translation="MLADAEYLRYGRQLMLAEVGEEGQARLKDKSVLIVGLGGLGSPLA
FT                   LYLAGAGVGTLWLADGDTVDSSNLPRQILFDSEAVNHSKAELARERLAAHNPLVELIAI
FT                   NQRLDAASLPEFVAEVDLVIDCCDNLATRQAINAACVAQGKPWVCAAAVGWQGQLMVRT
FT                   SSEHACYACLYPLDTEIKESCETSGVTGPLVGVMGSLQALEALKLLFGMQSPVAGTLRR
FT                   FDALAHQWQTLTLAPDPDCPVCGPHKEITP"
     atgttggctg atgctgaata cctgagatac ggccgccagc tgatgctggc ggaagtgggg        60
     gaggaagggc aggcgcggct gaaagataag tctgtgctga tcgtgggctt gggcgggctt       120
     ggctcgccgc tcgccctcta tctcgccggg gccggggtgg gcaccttgtg gctagccgat       180
     ggcgatacgg tcgattccag caatctgccg cgccagatcc tgttcgatag cgaggcggtc       240
     aaccactcca aggcggagct ggcccgcgag cggttggcgg cccacaaccc gctggtggag       300
     ctgattgcca tcaaccagcg gctcgatgcc gccagcctgc cggagtttgt ggccgaggta       360
     gatctggtga tcgactgctg cgacaacctc gccacccgcc aggccatcaa cgccgcctgc       420
     gtggctcagg gcaagccctg ggtctgtgcc gccgcagtgg gctggcaggg gcagttgatg       480
     gtgcgcacca gcagtgagca cgcctgctac gcctgcctct atccgctgga taccgagatc       540
     aaggagagct gcgagaccag cggcgttacc ggcccgttgg tcggggtgat gggctctttg       600
     caggcgctgg aggcattgaa actgctgttc gggatgcaaa gcccggtcgc cggcacattg       660
     cgccgtttcg acgcgctggc ccatcagtgg cagaccctca ctctggcccc cgatcccgac       720
     tgcccggttt gcgggccgca caaggaaatc accccatga                              759
//

If you have problems or comments...

PBIL Back to PBIL home page