(data stored in ACNUC7421 zone)

EMBL: CP000462.THIH

CP000462.THIH        Location/Qualifiers
FT   CDS_pept        473927..475198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiH"
FT                   /locus_tag="AHA_0444"
FT                   /product="thiazole biosynthesis protein ThiH"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF06968; match to protein
FT                   family HMM TIGR02351"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39165"
FT                   /db_xref="GOA:A0KFF1"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR012726"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFF1"
FT                   /protein_id="ABK39165.1"
FT                   /translation="MSSFSVSPEADVFSPPLPLGEGLGVRAEADSVLEGGEPCTPPPPK
FT                   GEAGRGLDFANRWQELEWDDIGMQIRAKTAADVARALSAPRRTLADFMALISPAAEAYL
FT                   PQMAAEAERLTRQRFGNTIGFYVPLYLSNLCANDCTYCGFSMSNRLKRKTLNAEEIERE
FT                   CLAIKARGFDSVLLVTGEHEHKVGLAYFREVMPIIRRHFSTVGMEVQPLSQDEYAELKS
FT                   LGLDSVMVYQETYHAPTYARHHLRGNKREIAWRLATPDRLGRAGIDKIGLGALIGLSSD
FT                   WRADSYFVAEHLAWLERHHWQSRYSLSFPRLRPCTGGLEPAVVMSDRQLAQLICAWRLF
FT                   SPTLDLSLSTRESATFRNGAVRLGITQMSAESRTQPGGYAEGDAEELEQFAIHDDRPVG
FT                   EVAAAVRQAGLQPVFKDWEPFLGR"
     atgtcctctt tctcggtttc tcccgaggct gatgtgttta gcccccctct ccctctggga        60
     gaggggctgg gggtgagggc agaggcagat tcggtgcttg aagggggcga gccctgcact       120
     cctccccctc ccaaggggga ggccgggagg gggttggatt ttgccaatcg ctggcaggag       180
     ctggagtggg acgatatcgg catgcagatc cgcgccaaaa ctgccgccga tgtggcccgc       240
     gccctgagcg ccccccgccg taccttggcc gattttatgg cgctgatctc cccagccgcc       300
     gaagcgtacc tgccgcagat ggcggccgag gccgagcggc tgactcgcca gcgctttggc       360
     aacaccatcg gcttctatgt gccgctctat ctgtcgaacc tctgcgccaa cgactgcacc       420
     tactgcggct tctccatgag caaccgcctc aagcgcaaga ccttgaatgc agaggagata       480
     gagcgcgagt gtctggccat caaggcgcgc ggtttcgaca gcgtgctgct ggtgaccggc       540
     gagcacgagc acaaggtggg gctcgcctat tttcgcgagg tgatgcccat catccgtcgc       600
     cacttcagca cggtagggat ggaggtgcag cccctctcgc aggatgaata tgccgaactg       660
     aaaagcctcg gcctcgattc ggtcatggtc tatcaggaga cctaccacgc ccccacctac       720
     gcccgccatc acctgcgcgg caacaagcgg gagatcgcat ggcgcctcgc gacgccggat       780
     cggctgggtc gtgccggtat cgacaagatc gggctggggg cgctgatcgg tctctcctcg       840
     gactggcgcg ctgacagcta ctttgtcgcc gagcatctcg cctggcttga gcgccaccac       900
     tggcagagcc gctactccct ctccttcccg cgtctgcgcc cctgcaccgg cgggctggag       960
     cctgccgtgg tcatgtcgga tcgccagctg gcccagctga tctgcgcctg gcgcctcttc      1020
     tcgccgacgc tggatttgtc gctctccacc cgcgagtcgg ctacgtttcg caacggcgcg      1080
     gtgcgccttg gcatcaccca gatgtcggcc gagtcgcgca cccagccggg tggctatgcc      1140
     gagggggatg cagaggagct ggagcagttt gccatccacg acgaccgccc ggtgggggaa      1200
     gtggccgccg ccgtgcggca ggccgggttg cagccggtgt tcaaggattg ggagcccttc      1260
     ctgggtcgat ag                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page