(data stored in ACNUC7421 zone)

EMBL: CP000462.TRKH

CP000462.TRKH        Location/Qualifiers
FT   CDS_pept        160937..162394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkH"
FT                   /locus_tag="AHA_0143"
FT                   /product="Trk system potassium uptake protein TrkH"
FT                   /note="identified by similarity to SP:P21166; match to
FT                   protein family HMM PF02386; match to protein family HMM
FT                   TIGR00933"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36858"
FT                   /db_xref="GOA:A0KEL5"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEL5"
FT                   /protein_id="ABK36858.1"
FT                   /translation="MQILSIIRIVGLLVALFSSTMLLPALVAFGYRDGGGAEFVNSFFI
FT                   ALLLGAALWFPNRHQKKDLRSKEGFLIVVLFWVVLGSVGALPFLLGEVPGMTVSEAFFE
FT                   SFSGLTTTGATVLTGLDNLPKAFLFYRQLLQWLGGMGIIVLAVAILPLLGIGGMQLYRA
FT                   EIPGPVKDNKVTPRIAETAKALWFIYLLLTSLCALAYWMAGMTLFDAICHSFSTLSVGG
FT                   FSTHDASIGFFNSPAINLITVVFLLLASVNFALHFMVFAHKPVRLSNYLRDSELKVFLS
FT                   IQCVLVLICFVSLLFHGHYATWQEALNHGLFQAVSLGTTTGYSTTSYAEWPSFLPMLLM
FT                   FSAFIGCCAGSTGGGIKVMRFMILFLQGMRELKRLVHPRAIYTLKLGRRAVPERIVEAV
FT                   WGYFATYIILFFIFMLLLLMTGLNEVTAFSAVAAAFTNVGPGLGEVSANFGKISATAQW
FT                   ILVVAMLFGRLEIFTLLVLFTPAFWRS"
     atgcagattc tgagcatcat tcgtatcgtt ggcctgctgg tcgcgctgtt cagttcgacc        60
     atgttgctgc ccgcgctggt cgcctttggc tatcgtgatg gcggtggtgc cgagttcgtc       120
     aactccttct tcatcgccct gctgctcggc gccgcgctct ggtttccaaa ccgccatcag       180
     aagaaagatc tcagatccaa ggaaggattt ctcatcgtcg tgctgttctg ggtggtgctg       240
     ggcagcgtgg gggccttgcc gttcctgctg ggagaggtgc ccggcatgac ggtgtcggag       300
     gccttcttcg agtcgttttc cggcctgacc accacggggg cgaccgtgct caccgggctg       360
     gacaatctgc ccaaggcgtt tctgttctat cgccagctgc tgcagtggct ggggggcatg       420
     gggatcatag tgctggcggt ggccatactg ccactgctcg gcatcggggg catgcagctc       480
     tatcgcgccg aaattccggg gccggtcaag gacaacaagg tcaccccgcg catcgccgag       540
     acggccaagg cactctggtt catctatctg ttgctcactt ccctctgtgc cctggcgtac       600
     tggatggcgg gcatgaccct gttcgatgcc atctgccact ccttctccac cctgtcggtg       660
     ggcggcttct cgacccacga cgccagcatc ggctttttca acagcccggc catcaacctg       720
     attactgtgg tgtttctgct gctggcgagc gtcaactttg ccctgcactt catggtgttc       780
     gcccacaagc cggtgcggct gagcaactat ctgcgcgact ccgagctgaa ggtgtttctg       840
     agcatccagt gtgtgctggt gctgatctgc ttcgtttccc tcttgtttca cggccattac       900
     gccacctggc aggaggcgct caaccacggt ctgttccagg cggtgtcgct gggcacgacc       960
     accggctaca gcacgaccag ctatgcggag tggccctcct ttctgcccat gctgctgatg      1020
     ttctccgcct tcatcggctg ctgcgccggc agtaccgggg gcggcatcaa ggtgatgcgc      1080
     ttcatgatcc tgttcctgca ggggatgcgc gagctgaagc ggctggtgca cccgcgcgcc      1140
     atctataccc tcaagctggg tcgtcgtgcc gtgcctgagc ggatcgtgga ggcggtgtgg      1200
     ggctactttg ccacctacat catcctgttc ttcatcttta tgttgttgct gctgatgacc      1260
     ggcttgaacg aggtgaccgc tttctctgcc gtggcggcgg cgttcaccaa cgtggggccg      1320
     gggctgggcg aggtgtcggc caacttcggc aagatctcgg caacggcaca atggatactg      1380
     gtcgtcgcca tgctgtttgg ccgattggaa atcttcactc ttctggtact gtttacccct      1440
     gcattctggc gtagttga                                                    1458
//

If you have problems or comments...

PBIL Back to PBIL home page