(data stored in ACNUC7421 zone)

EMBL: CP000462.TRX

CP000462.TRX         Location/Qualifiers
FT   CDS_pept        109476..109802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trx"
FT                   /locus_tag="AHA_0098"
FT                   /product="thioredoxin"
FT                   /note="identified by match to protein family HMM PF00085;
FT                   match to protein family HMM TIGR01068"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36091"
FT                   /db_xref="GOA:A0KEH0"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEH0"
FT                   /protein_id="ABK36091.1"
FT                   /translation="MSDKIVQLSDASFEADVIKADGAVLVDFWAEWCGPCKMIAPILNE
FT                   VAQEYAGRVTVAKLNIDHNADTPPKYGIRGIPTLLLFKNGEVAATKVGALSKTQLKEFL
FT                   DGNL"
     atgagtgaca agattgttca gctgagcgat gccagcttcg aggcagatgt aatcaaagcc        60
     gatggcgccg ttctggtcga cttctgggcc gaatggtgtg gtccgtgcaa gatgattgcc       120
     ccgatcctga acgaagtcgc ccaagagtat gccggtcgcg tgaccgtggc gaaattgaac       180
     atcgaccata acgccgacac tccgcccaag tatggcattc gtggtattcc gaccctcttg       240
     ctgttcaaga atggcgaagt ggcagcgacc aaggtcggtg cactgtccaa gactcagctg       300
     aaagagtttc tggacggtaa cctgtaa                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page