(data stored in ACNUC7421 zone)

EMBL: CP000462.TYRS-1

CP000462.TYRS-1      Location/Qualifiers
FT   CDS_pept        615563..616831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS-1"
FT                   /locus_tag="AHA_0581"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="identified by match to protein family HMM PF00579;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR00234"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39461"
FT                   /db_xref="GOA:A0KFT8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KFT8"
FT                   /protein_id="ABK39461.1"
FT                   /translation="MINPHLLDELTRRGLVAQNSDPVALADHLATPRTVYCGFDPTAGS
FT                   LHIGHLVPLLMLRRFQLAGHTPVALVGGATGLIGDPSFKATERNLNSSETVQGWVASLS
FT                   AQIKALLPASEGLAAPLLVNNADWMGQMSALDFLRDIGKHFSVNAMLVRESVRQRLARP
FT                   DQGISFTEFSYALLQSQDYAVLNQRLGCTLQIGGNDQWGNITSGMDLTRRLHQAQVYGM
FT                   TLPLITKADGTKFGKTEGGAIWLDPALTSPYAFYQFWLGTADEDVYRFLRYYSFMPLTE
FT                   IEALEAEDAKRQGRKLAQQVLADELTELVHGKGALAAAQRISELLFSGEVARLGESDLA
FT                   QLAQDGMPGWRIEGETDLVTLLVESGLANSKRIARELLAAGAISLNGEIRREEPLRAAD
FT                   RLFGRHLLLRRGKKQYRLVTWQG"
     atgatcaacc cccacctgct cgatgagctg acccgacgtg gcctggtggc ccagaattcc        60
     gacccggtgg cgctggctga ccatcttgcc accccgcgca ccgtctactg cgggttcgat       120
     cccaccgctg gcagcctgca catcggccat ctggtgccgc tcttgatgct gcgccgcttc       180
     cagctggcgg gccacacccc ggtggcgttg gtgggcggag ccaccggcct tatcggcgat       240
     cccagcttca aggcgaccga gcgcaacctc aacagctccg agacggtgca gggctgggtg       300
     gccagcctgt cggcccagat aaaagcgctg ctgccggcca gcgaagggct ggcggcgccg       360
     ctgctggtca acaacgccga ctggatgggg cagatgtccg ccctcgattt tctgcgcgac       420
     atcggcaagc acttctcggt caacgccatg ctggtccgcg aatcggtgcg ccagcggctg       480
     gcccgcccgg atcagggcat ctccttcacc gagttctcct acgccctgct gcaatcccag       540
     gactacgcgg tgctcaacca gcgcctcggc tgcaccctgc agatcggcgg caacgaccag       600
     tggggcaaca tcaccagcgg catggacctc acccgccgcc tccatcaggc tcaggtctat       660
     ggcatgacgc tgccgctcat caccaaggcg gacggcacca agttcggcaa gaccgaaggg       720
     ggggcaattt ggctcgatcc ggcgctcacc tcgccctacg ccttctacca gttctggctc       780
     ggcaccgcgg acgaggatgt ctaccgtttc ctgcgctact acagcttcat gccgctgacc       840
     gagattgagg cgctggaggc ggaggatgcg aagcggcagg ggcgcaagct ggcccagcag       900
     gtgctggccg acgagctgac cgagctggta cacggcaagg gggcgctggc ggcggcgcag       960
     cgcatcagcg agctgttgtt cagtggcgag gtggcccgcc ttggcgagag tgatctggcc      1020
     cagctggcgc aggatggcat gccgggctgg cgaatcgagg gggaaacaga tctggtgacc      1080
     ctgctggtgg agagcggtct ggccaactcc aagcgcatcg cccgcgagct gctggcggca      1140
     ggcgccatca gcctcaatgg cgagatccgc cgggaagagc cactgagggc ggctgaccgg      1200
     ctgttcggcc gccacctgct gctgcgccgg ggtaagaagc agtaccggct ggtgacgtgg      1260
     caggggtga                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page